Unlock instant, AI-driven research and patent intelligence for your innovation.

An artificial binding protein capable of specifically recognizing allophycocyanin and its obtaining method

A technology of allophycocyanin and binding protein, applied in chemical instruments and methods, botany equipment and methods, biochemical equipment and methods, etc. Poor capacity and other issues

Active Publication Date: 2021-11-30
INST OF AQUATIC LIFE ACAD SINICA
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, since the structure of allophycocyanin and phycocyanin is very similar, and it is difficult to completely separate them in the process of antigen preparation and purification, it is difficult to prepare polyclonal antiserum or hybridoma monoclonal antibodies by immunizing animals with traditional antigens. achieve higher specificity
Currently commercial allophycocyanin antibodies are not very specific and have more or less cross-reactivity with phycocyanin
In addition, the antibody molecule itself has a large molecular weight and poor tolerance to acid, alkali and temperature, which greatly limits its application in the detection and purification of antigen molecules.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • An artificial binding protein capable of specifically recognizing allophycocyanin and its obtaining method
  • An artificial binding protein capable of specifically recognizing allophycocyanin and its obtaining method
  • An artificial binding protein capable of specifically recognizing allophycocyanin and its obtaining method

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0080] In order to better explain the present invention and facilitate understanding, the present invention will be described in detail below through specific embodiments in conjunction with the accompanying drawings.

[0081]The overall concept of the present invention is to select highly stable, highly soluble protein A dimer as the skeleton protein, and use genetic engineering technology to treat 8-24 protein A dimers exposed on the molecular surface Randomly mutate amino acid positions to form a variable protein-binding region on the surface of the molecule, thereby constructing a backbone protein library. Then, clones that can specifically bind to target molecules are screened from the protein library by surface display technology.

[0082] Further, the method of the present invention is divided into the following steps:

[0083] S1: Phage preparation of phage display protein A dimer mutant library to obtain protein A dimer mutant library expressed on the surface of phag...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
melting pointaaaaaaaaaa
Login to View More

Abstract

An artificial binding protein that can specifically recognize allophycocyanin, its amino acid sequence is: HMVDNKFNKEIVNAITEIHHLPNLNLEQRWAFIFSLFDDPSQSANLLAEAKKLNDAQAPKSGGGGSGGGGIGVDNKFNKEWQNAHNEIIWLPNLNWEQKWAFINSLYDDPSQSANLLAEAKKLNDAQAPKAAASDYKDDDDKLEHHH. The protein has the characteristics of strong specificity, high affinity, strong thermal stability, strong acid-base tolerance and the like, and can be applied in the fields of detection and purification of allophycocyanin and the like. In addition, the present invention also relates to a DNA fragment for encoding the above-mentioned artificial binding protein and a method for obtaining the artificial binding protein. In the present invention, by selecting highly stable and highly soluble protein A dimer as the backbone protein, on the basis of it, through processes such as genetic engineering transformation, construction of mutant library, affinity screening, etc., the finally obtained class has antigen binding active protein.

Description

technical field [0001] The invention relates to the technical field of artificial binding proteins, in particular to an artificial binding protein capable of specifically recognizing allophycocyanin and a method for obtaining it. Background technique [0002] Phycobiliprotein is an important light-harvesting pigment protein present in Cyanophyceae, Phodophyceae, Cryptophyceae and a few dinoflagellates (Pyrrophyceae). According to literature records, phycobiliproteins are generally divided into three categories: Phycocyanin (Phycocyanin, referred to as PC, with a maximum absorption peak of 620nm, which is azure blue), phycoerythrin (Phycoerythrin, referred to as PE, with a maximum absorption peak of 562nm, which is purple) red) and Allophycocyanin (APC for short, the maximum absorption peak is 652nm, appearing sky blue). These proteins can not only be used as natural pigments in the fields of food, cosmetics and dyes, but also have special effects on cancer, diabetes, cardio...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/31C12N15/31G01N33/68
CPCC07K14/31G01N33/68G01N2333/31G01N2333/795
Inventor 袁丽杨苗韩丹翔胡强
Owner INST OF AQUATIC LIFE ACAD SINICA
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More