Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Recombinant collagen product for skin light injury repair

A technology for recombining collagen and photodamage, applied in the field of dermatology, can solve the problems of easy inactivation of collagen, difficult quality control, complicated processing process, etc., and achieve the effects of good water solubility, water retention, and good biocompatibility

Active Publication Date: 2021-10-22
胶原蛋白(武汉)生物科技有限公司
View PDF6 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] Collagen currently on the market mainly comes from animal tissues such as fish, pigs, and cattle, and there may be a risk of virus transmission. Moreover, animal collagen is difficult to control because of its different sources, and there are also problems such as poor water solubility, complicated processing, and preparation. Defects such as easy inactivation of collagen

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Recombinant collagen product for skin light injury repair
  • Recombinant collagen product for skin light injury repair
  • Recombinant collagen product for skin light injury repair

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0035] The preparation of embodiment 1 recombinant collagen

[0036] 1. Determine the amino acid sequence comprising recombinant collagen as shown below:

[0037] MHHHHHHADEQEEKAKVRTELIQELAQGLGGFEKKNFPTLGDEDLDHTYMTKLLTYLQEREQAENSWRKRLLKGIQDHALDLVPRGSPGLPGPRGEQGPTGPTGPAGPRGLQGLQGLQGERGEQGPTGPAGPRGLQGERGEQGPTGLAGKAGEAGAKGETGPAGPQGPRGEQGPQGLPGKDGEAGAQGRPGKRGKQGQKGEKGEPGTQGAKGDRGETGPVGPRGERGEAGPAGKDGERGFPGERGVEGQNGQDGLPGKDGKDGQNGKDGLPGKDGKDGQNGKDGLPGKDGKDGQDGKDGLPGKDGKDGLPGKDGKDGQPGKPGKYGPPGPPGPPGPPGPPGPPGPPGPPGPPGPP。

[0038] 2. Construction of recombinant collagen expression strains

[0039] Synthesize the nucleotide sequence encoding the amino acid sequence described in 1 above, construct the expression plasmid containing the nucleotide sequence, and confirm the successful synthesis of the plasmid by DNA sequencing; transform the plasmid into Escherichia coli BL21-DE3 strain, and transform the successfully transformed positive clone After adding glycerin to the strain, store i...

Embodiment 2

[0043] The detection of embodiment 2 recombinant collagen

[0044] 1. Circular Dichroism Detection

[0045] The recombinant collagen prepared in Example 1 was dissolved in PBS buffer solution (pH 7.0), sodium acetate buffer solution (pH 3.0) and ethylene glycol, respectively, with a final concentration of 1 mg / mL. The circular dichroism spectrometer was used to scan the spectrum of the above-mentioned recombinant collagen solution. The scanning wavelength was 210-260nm, the scanning temperature was 4°C, the wavelength step was 0.5nm, and the average time was 0.5 seconds. The CD spectrum was the average value of three scans.

[0046] The result is as figure 1 As shown, the recombinant collagen prepared in Example 1 of the present invention has a positive peak at around 220 nm, which conforms to the triple helical structure characteristic of collagen, and is a recombinant collagen with a triple helix structure.

[0047] 2. Cytotoxicity experiment

[0048] HeLa cells grown com...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the field of skin medicine, and particularly relates to a recombinant collagen product for skin ultraviolet injury repair. The invention provides recombinant collagen which has a good repairing effect on skin damaged by ultraviolet rays, has a good adhesion effect on fibroblasts, can promote proliferation of the fibroblasts of the skin, has no stimulation effect on the skin and is good in safety. Meanwhile, the recombinant collagen can remarkably improve inflammation symptoms after skin injury, maintain moisture of an epidermal layer, induce growth of skin epidermal cells, help repair of corium layer collagenous fibers and repair skin with light injury, and can be used for preparing cosmetics or medical beauty products.

Description

technical field [0001] The invention belongs to the field of dermatology, and in particular relates to a recombinant collagen product used for repairing skin light damage. Background technique [0002] The skin is the largest organ of the human body, its total area can reach 1.5-2 square meters on average, and its total weight accounts for 5%-15% of the total body weight. The skin has an important barrier function, which can protect the tissues and organs in the body from external viruses and physical and chemical damage. It also has functions such as sweating, feeling cold, heat and pressure, and regulating body temperature. In daily life, the skin is inevitably exposed to sunlight, and the ultraviolet rays in the sun can cause photodamage to the skin, including phototoxicity, photosensitivity, photoaging, and photocarcinogenesis. Most of the ultraviolet rays in sunlight are UVA with a wavelength of 320-400nm. UVA can penetrate into the epidermis and cause photooxidation o...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A61K8/65A61Q17/04A61Q19/00A61K38/39A61P17/00A61P17/16A23L33/17
CPCA61K8/65A61Q17/04A61Q19/004A61K38/39A61P17/00A61P17/16A23L33/17A23V2002/00A23V2200/318A23V2250/5422
Inventor 肖建喜付彩虹
Owner 胶原蛋白(武汉)生物科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com