Modified transferrin fusion proteins

A fusion protein, transferrin technology, applied in transferrin, animal/human proteins, hybrid peptides, etc., can solve problems such as unmodified or modified

Inactive Publication Date: 2008-05-14
BIOREXIS PHARMA CORP
View PDF73 Cites 11 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0012] However, transferrin fusion proteins have not been modified or engineered to extend the serum half-life of therapeutic proteins or peptides, or to increase bioavailability by reducing or inhibiting glycosylation of Tf components, or to reduce or prevent iron and / or or Tf receptor binding

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Modified transferrin fusion proteins
  • Modified transferrin fusion proteins
  • Modified transferrin fusion proteins

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0543] By fusing one or more copies of the nucleotide sequence encoding the anti-fusion HIV-1 peptide (T-20) with the nucleotide sequence of TF, a fusion protein containing the modified Tf of the sequence and the peptide is prepared, The resulting fusion protein has a peptide fused to the N- or C-terminus of Tf.

[0544] In one embodiment, the Tf portion of the fusion protein is engineered so that it is not glycosylated when produced in yeast. As mentioned above, human transferrin has two N-linked glycosylation sites at approximately N413 and approximately N611. N-linked glycosylation sites contain the sequence N-X-S / T. In one embodiment, N(Asn) is changed to Q(Gln); other changes can also be made, such as Asn to Ala or Ser to any other amino acid.

[0545] Specifically, N413 and N611 codons were converted to GAT and GAC by oligonucleotide-directed mutagenesis using the dut- and ung-method. See Kunkel et al. (1985) Proc. Natl. Acad. Sci. 82:488-492. Mutagenic oligonucleoti...

Embodiment 2

[0589] INGAP fusions were prepared using the reverse translated human INGAP amino acid sequence. The protein sequence is as follows: sp|Q92778|PBCG_HUMAN Human INGAP

[0590] MMLPMTLCRMSWMLLSCLMFLSWVEGEESQKKLPSSRITCPQGSVAYGS

[0591] YCYSLILIPQTWSNAELSCQMHFSGHLAFLLSTGEITFVSSLVKNSLTAYQY

[0592] IW[IGLHDPSHGTLPNG]GWKWSSSNVLTFYNWERNPSIAADRGYCAVLS

[0593] QKSGFQKWRDFNCENELPYICKFKV (SEQ ID NO: 17)

[0594] Back translation into DNA (codons optimal for yeast) gave the following sequences (SEQ ID NO: 18 and 19).

[0595] 1 atgatgttgc caatgacttt gtgtagaatg tcttggatgt tgttgtcttg tttgatgttt

[0596] m m l p m t l c r m s w m l l s c l m f

[0597] 61 ttgtcttggg ttgaaggtga agaatctcaa aaaaaa ttgc catcttctag aattacttgt

[0598] l s w v e q e e s q k k l p s s r i t c

[0599] 121 ccacaaggtt ctgttgctta tggttcttat tgttattctt tgattttgat tccacaaact

[0600] p q g s v a y g s y c y s l i l i p g t

[0601] 181 tggtctaatg ctgaattgtc ttgtcaaatg catttttctg gtcatttggc ...

Embodiment 3

[0680] The peptides given below have been shown to mimic EPO activity by causing dimerization of the EPO receptor. The cyclic peptide has no homology to EPO. To be active, the peptide has to act with another peptide (ie as a dimer) so that the two copies of the receptor come close enough to form an active complex. For many peptides, peptide dimers have only a short half-life, which could benefit from an extended half-life by fusion with transferrin. In this example, two peptides were added to the transferrin backbone.

[0681] 1 ggtggtactt actcttgtca ttttggtcca ttgacttggg tttgtaagcc acaaggtggt

[0682] g g t y s c h f g p l t w v c k p q g g

[0683] SEQ ID NO: 24 and 25.

[0684] Peptides could be successfully added between His289 and Gly290 of transferrin as described in detail by Ali et al. The inherent repeat of the transferrin molecule (two domains mirroring each other) means that the peptide can be inserted between Glu625 and Thr626 in the repeat region of the ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
Login to View More

Abstract

The present invention discloses modified fusion proteins of transferrin and therapeutic proteins or peptides, which have prolonged serum half-life or increased serum stability. Preferred fusion proteins include those modified such that the transferrin component exhibits no or reduced glycosylation, binding to iron, and / or binding to the transferrin receptor.

Description

[0001] This case is a divisional application of an invention application with a filing date of August 30, 2002, a Chinese application number of 02821637.7, and an invention title of "modified transferrin fusion protein". [0002] related application [0003] This application claims priority to US Provisional Application 60 / 315,745, filed August 30, 2001, and US Provisional Application 60 / 334,059, filed November 30, 2001, both of which are incorporated herein by reference in their entireties. technical field [0004] The present invention relates to therapeutic proteins or peptides with increased serum stability or increased serum half-life, in particular therapeutic proteins or peptides fused to or inserted into transferrin molecules which are modified so as to reduce or Glycosylation, iron binding and / or transferrin receptor binding are inhibited. Background technique [0005] Therapeutic proteins or peptides in their native state or recombinantly produced are generally un...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K19/00C07K14/79C12N15/62C12N15/85A61K47/48A01KA61KA61K47/42C07HC07KC12NC12P
Inventor克里斯托弗·P·普赖尔
OwnerBIOREXIS PHARMA CORP