Unlock instant, AI-driven research and patent intelligence for your innovation.

Peptides of regulatory or accessory proteins of HIV, compositions and the utilization thereof

A technology of polypeptide composition and vaccine composition, which is applied in the field of peptide sequences and can solve problems such as unsatisfactory antigenic determinants

Inactive Publication Date: 2009-04-01
PEPTCELL
View PDF0 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0059] However, while the known epitopes have been extensively studied, no satisfactory epitopes have been identified that could form the basis of an HIV vaccine
Furthermore, a vaccine based on any single epitope, even if it may confer some protection, may only be specific for a particular HLA, rendering the vaccine ineffective for most populations

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Peptides of regulatory or accessory proteins of HIV, compositions and the utilization thereof
  • Peptides of regulatory or accessory proteins of HIV, compositions and the utilization thereof
  • Peptides of regulatory or accessory proteins of HIV, compositions and the utilization thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[6158] Embodiment 1, the reactivity of anti-HIV antigen

[6159] The aim of this study was to evaluate the reactivity of the above HIV peptides and their ability to induce specific Th1-type cytokine responses against natively processed and presented HIV proteins in human HLA (HLAA*0201).

[6160] As a background to the experiment, it is useful to understand that Th1 and Th2 responses are defined by the pattern of cytokines produced by the helper T cells they comprise. However, this does not mean that the remaining lymphocytes (T cells and B cells) involved in these specific responses also do not produce cytokines that help drive the characteristic pattern of the responses in which they participate. Thus, Th1 -like responses are characterized by the production of IFN-γ and IL-2, which lead to stimulation of CD8+ CTL responses and associated (in mice) IgG2a antibody responses. IFN-γ responses can be generated by CD4+ helper T cells 1 as well as by CD8+ T cells which also form p...

Embodiment 2

[6228] Example 2. HIV-v Immunization Can Induce Antigen-Specific Responses Against Human Cells Infected by HIV Field Isolates

[6229] The aim of this study was to evaluate whether immunization with identified HIV conserved T-cell polyepitope peptides (HIV-v) could induce antigen-specific responses against human cells infected with HIV field isolates.

[6230] Materials and methods

[6231] Peptides, Viruses and Cell Lines

[6232] The candidate vaccine (HIV-v) used in this study consists of multiple polypeptides (i.e., P1: amino acids 51 to 80 of VPR (SED ID 1); P2: amino acids 142 to 181 of VIF (SED ID 1); ID 2); P3: amino acids 69 to 95 of REV (SED ID 3); P4: amino acids 81 to 123 of NEF (SED ID 4)), these peptides were synthesized by Fmoc chemical method, and re- Suspended in DMSO in PBS (DMSO concentration in the final preparation was less than 10%). Boil-denatured lysozyme (Sigma) was used as a control irrelevant preparation (NRP-v).

[6233] Infectious HIV-1 strains...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ ID 1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR; SEQ ID 2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT; SEQ TD 3 EPVPLQLPPLERLTLDCSEDCGTSGTQ; SEQ ID 4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.

Description

technical field [0001] The present invention relates to peptide sequences, and compositions containing the peptide sequences, and in particular to immunodeficiency virus vaccines, such as vaccines against human immunodeficiency virus (HIV) and / or other immunodeficiency viruses, which are also effective against acquired immunodeficiency Syndrome (AIDS) useful. These vaccines comprise said sequences and said compositions. The invention also relates to the use of these sequences and compositions. In particular, it relates to vaccines that protect against multiple strains of viruses, including existing viruses and future viruses mutated from existing viruses (such as mutants of existing HIV strains). Background technique [0002] Defense against disease is crucial to the survival of all animals and the defense mechanism employed for this purpose is the animal's immune system. Understanding the immune system is therefore key to understanding the development of new and better t...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/16A61K38/16A61P31/18
Inventor 格雷戈里·艾伦·斯特洛夫威尔逊·罗梅罗·卡帕罗斯-万德雷
Owner PEPTCELL
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More