54 results about "Venom Protein" patented technology

An immunogenic detoxified protein is provided which comprises the amino acid sequence of subunit A of an E. coli heat labile toxin (LT-A) or a fragment thereof in which at least amino acid Ala-72 of the A subunits mutated, preferably by substitution with Arg. The toxoid is useful as vaccine against an enterotoxigenic strain of E. coli and is produced by recombinant DNA means by site-directed mutagenesis. It is also an effective adjuvant.

The invention provides an insecticidal protein Cryl A. 301 which has 1) an amino acid sequence shown by SEQ ID No.2; or 2) an amino acid sequence which is obtained by substituting the amino acid sequence shown by SEQ ID No.2 or decreasing and or increasing one or more amino acid(s) of the amino acid sequence shown by SEQ ID No.2, and has the same function. The experiment in vitro proves that the reformed and synthesized Bt gene toxin production protein has remarkable insecticidal effect for european corn borer. The insecticidal protein Cryl A. 301 can be efficiently expressed in monocotyledons, thus being used for producing insect-resistant transgenic plants.

Disclosed herein are nucleotide sequences encoding an insecticidal protein exhibiting Lepidopteran inhibitory activity, as well as novel insecticidal proteins referred to herein as a BCW 001, BCW 002, BCW 003, and BCW toxic protein-containing chimeras and BCW toxin insecticide, transgenic plants expressing the chimeras or the insecticide, and methods for detecting the presence of the nucleotide sequences or the insecticide in a biological sample.

The invention discloses a method of determining bacillus thuringiensis toxic protein CrylAc. The method comprises the steps that: Fe3O4@Au nana-particles combining with a transgenic Bt toxic protein CrylAc primary antibody is modified onto the surface of a magnetic control glassy carbon electrode, and specific immune reaction is carried out on the magnetic control glassy carbon electrode with an antigen and a GOD labeled secondary antibody to form a compound with a sandwich structure; an electrogenerated chemiluminescence immunosensor is developed to be used for detecting the concentration of transgenic Bt toxic protein CrylAc; glucose is catalyzed and oxidized by using GOD to generate H2O2; voltage is applied to a working electrode to excite luminal to be oxidized; a luminal oxide and the H2O2 react to generate an electrochemiluminescence signal; an electrochemiluminescence response is strengthened along with the increase of the concentration of the GOD; and the electrochemiluminescence signal has a linear relation with the concentration of the transgenic Bt toxic protein CrylAc within a range of 0-6ng / mL. The method has high sensitivity and low detection limit, is widely applied and supplies a wide application prospect of reliably and ultra-sensitively detecting the toxic protein of a transgenic plant.

The present invention concerns methods and compositions for treating or preventing a bacterial infection, particularly infection by a Staphylococcus bacterium. The invention provides methods and compositions for stimulating an immune response against the bacteria. In certain embodiments, the methods and compositions involve a non-toxigenic Protein A (SpA) variant. In some embodiments, the methods and compositions involve SdrD, ClfA, and / or FnbpB polypeptides.

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ ID 1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR; SEQ ID 2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT; SEQ TD 3 EPVPLQLPPLERLTLDCSEDCGTSGTQ; SEQ ID 4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.

The invention relates to a microorganism protein and a gene, and particularly discloses an ochratoxin detoxification protein and an encoding gene of the ochratoxin detoxification protein. The amino acid sequence of the protein is shown as SEQ ID NO.1, and the encoding gene sequence is shown as SEQ ID NO.2. The recombinant bacteria structured by gene sequence can express the protein with ochratoxin detoxification activity.

The invention discloses artificially synthesized insect-resistant protein mCry1Ia2. The invention also discloses a nucleic acid molecule of the protein, and a recombinant vector, a host cell or a recombinant bacterium of the nucleic acid molecule. The invention also discloses applications of the protein, the nucleic acid molecule and the recombinant vector of the nucleic acid molecule, the host cell or the recombinant bacteria to regulation and control of plant insect resistance, insect killing or improvement in insect resistance of transgenic plants, and preparation of insecticides or insectcontrol preparations. In vitro experiments show that the modified Bt toxin-producing protein has higher insecticidal activity against ostrinia nubilalis, and has significant insecticidal effect on thepopulation of ostrinia nubilalis resistant to Cry1Ab, Cry1F and Cry1Ie toxin protein. A novel plant expression vector is constructed by a constitutive promoter, and the insect-resistant gene mCry1Ia2can be stably and efficiently expressed in monocotyledonous plants to be further used for producing the insect-resistant transgenic plants.

The invention discloses the construction of a high-copy and high-expression recombinant plasmid and its application in exogenous gene expression, and relates to the technical field of genetic engineering. In the present invention, the pcDNA3.1(-) plasmid is used as the backbone, and the cumate-cymR inducible expression regulatory unit is loaded between the pUC ori high-copy replicon and the Ampicillin resistance gene, and at the same time, the multiple cloning site downstream of the pET-28a T7 promoter Point, 6xHis coding sequence and T7 transcription termination sequence were inserted downstream of the cumate-cymR regulatory unit to construct a recombinant plasmid DN-001 with high replication and high expression. The recombinant plasmid DN‑001 of the present invention has the advantages of being the most economical, the most convenient, and high yield, making the recombination of gene expression vectors time-saving and labor-saving; it can be applied to the production of large doses of recombinant proteins; at the same time, it effectively suppresses leaky expression, making This vector is especially suitable for the expression of toxic proteins, which makes this vector have broad market prospects.

A method for developing capture agents for target proteins employs a compound library to find cyclic peptide sequences that bind the target protein. The target protein is also reacted with a clickable group-provider reagent to provide the protein with clickable groups. The compounds in the library are provided with complementary clickable groups that bind the clickable group on the target protein when the peptide sequences bind the target protein. In some embodiments, the cyclic peptide sequences that bind the target protein are incorporated into constructs having one or more arms that can serve as capture agents or potential treatments against the pathogens from which the target protein is derived. Some embodiments provide pharmaceutical compositions for immunoassays, diagnostics, therapeutics or the like, that employ the constructs.

The invention relates to the technical field of molecular biology and immunology, in particular to an EB virus BALF4 protein epitope. The invention provides an the EB virus BALF4 protein epitope. The EB virus BALF4 protein epitope is shown as SEQ ID NO: 1, provides a nucleic acid molecule for coding the epitope, and also provides an antigen protein, a specific antibody and application of the epitope. The epitope has good conservative property, sensitivity and specificity, and a prepared antibody is high in titer and can be applied to clinical diagnosis and molecular mechanism research.