Fully human egfr ScFv tobacco codon-biased gene sequence and its obtaining method and application
A technology of codon bias and gene sequence, which is applied in the field of fully human EGFRScFv tobacco codon bias gene sequence and acquisition, can solve problems such as the construction and application of fully human anti-EGFRScFv, poor vascular permeability, and difficulties in clinical application. , to achieve good biological characteristics, low price and high affinity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0035] A method for obtaining a fully human EGFR ScFv tobacco codon-biased gene sequence, comprising the following steps:
[0036] a. Obtaining the fully human EGFR ScFv gene sequence, linking the heavy chain variable region (VH) DNA sequence with the light chain full-length (VL) DNA sequence through the connecting peptide (Linkr) to obtain the VH-L-VL gene sequence ;
[0037] The nucleotide sequence included in the heavy chain variable region (VH) DNA sequence is shown in SEQ ID NO2.
[0038] The nucleotide sequence included in the light chain full-length (VL) DNA sequence is shown in SEQ ID NO3.
[0039] The nucleotide sequence included in the connecting peptide (Linkr) is shown in SEQ ID NO4.
[0040] The nucleotide sequence included in the obtained VH-L-VL gene sequence is shown in SEQ ID NO5.
[0041] b. Alteration of the fully human EGFR ScFv gene sequence, changing the tobacco codon preference gene sequence to the fully human EGFR ScFv gene sequence to obtain a changed...
Embodiment 2
[0049] Restriction sites, amino acid sequence analysis
[0050] The bioinformatics software BIOXM2.6 was used to analyze the enzyme cleavage site and amino acid sequence of the fully human EGFR ScFv tobacco codon-biased gene sequence.
[0051] The amino acid sequence encoded by the fully human EGFR ScFv tobacco codon bias gene sequence is:
[0052] SSRMHHHHHHMDFQVQIFSFLLISASVIISRGQVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQHFDHLPLAFGGGTKVEIKR***GSG
[0053] The codable amino acid sequence is shown in SEQ ID NO8.
[0054] The amino acid sequence encoded by the fully human EGFR ScFv tobacco codon bias gene sequence is:
[0055] DFQVQIFSFLLISASVIISRGQVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTI...
Embodiment 3
[0059] ORF analysis
[0060] The ORF Finder provided by the online software BIOXM2.6 was used to analyze the sequence of the fully human EGFR ScFv tobacco codon preference gene sequence and predict its physical and chemical properties.
[0061] Results: Through the analysis of physical and chemical properties, it can be known that the protein encoded by the fully human EGFR ScFv tobacco codon bias gene sequence is a stable protein.
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com