Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Fully human egfr ScFv tobacco codon-biased gene sequence and its obtaining method and application

A technology of codon bias and gene sequence, which is applied in the field of fully human EGFRScFv tobacco codon bias gene sequence and acquisition, can solve problems such as the construction and application of fully human anti-EGFRScFv, poor vascular permeability, and difficulties in clinical application. , to achieve good biological characteristics, low price and high affinity

Inactive Publication Date: 2019-01-18
LIAOCHENG UNIV
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, since most of the monoclonal antibodies prepared at present are of mouse origin, it is easy to produce human anti-mouse antibody reaction in vivo, and their large molecular weight and poor vascular permeability have brought certain difficulties to clinical application.
However, there have been no reports on the construction and application of fully human anti-EGFR ScFv

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Fully human egfr ScFv tobacco codon-biased gene sequence and its obtaining method and application
  • Fully human egfr ScFv tobacco codon-biased gene sequence and its obtaining method and application
  • Fully human egfr ScFv tobacco codon-biased gene sequence and its obtaining method and application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0035] A method for obtaining a fully human EGFR ScFv tobacco codon-biased gene sequence, comprising the following steps:

[0036] a. Obtaining the fully human EGFR ScFv gene sequence, linking the heavy chain variable region (VH) DNA sequence with the light chain full-length (VL) DNA sequence through the connecting peptide (Linkr) to obtain the VH-L-VL gene sequence ;

[0037] The nucleotide sequence included in the heavy chain variable region (VH) DNA sequence is shown in SEQ ID NO2.

[0038] The nucleotide sequence included in the light chain full-length (VL) DNA sequence is shown in SEQ ID NO3.

[0039] The nucleotide sequence included in the connecting peptide (Linkr) is shown in SEQ ID NO4.

[0040] The nucleotide sequence included in the obtained VH-L-VL gene sequence is shown in SEQ ID NO5.

[0041] b. Alteration of the fully human EGFR ScFv gene sequence, changing the tobacco codon preference gene sequence to the fully human EGFR ScFv gene sequence to obtain a changed...

Embodiment 2

[0049] Restriction sites, amino acid sequence analysis

[0050] The bioinformatics software BIOXM2.6 was used to analyze the enzyme cleavage site and amino acid sequence of the fully human EGFR ScFv tobacco codon-biased gene sequence.

[0051] The amino acid sequence encoded by the fully human EGFR ScFv tobacco codon bias gene sequence is:

[0052] SSRMHHHHHHMDFQVQIFSFLLISASVIISRGQVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYFCQHFDHLPLAFGGGTKVEIKR***GSG

[0053] The codable amino acid sequence is shown in SEQ ID NO8.

[0054] The amino acid sequence encoded by the fully human EGFR ScFv tobacco codon bias gene sequence is:

[0055] DFQVQIFSFLLISASVIISRGQVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGHIYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTGAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTI...

Embodiment 3

[0059] ORF analysis

[0060] The ORF Finder provided by the online software BIOXM2.6 was used to analyze the sequence of the fully human EGFR ScFv tobacco codon preference gene sequence and predict its physical and chemical properties.

[0061] Results: Through the analysis of physical and chemical properties, it can be known that the protein encoded by the fully human EGFR ScFv tobacco codon bias gene sequence is a stable protein.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a human EGFR ScFv tobacco codon preference gene sequence as well as an acquiring method and an application thereof. The acquiring method of the gene sequence comprises the following steps: acquiring a human EGFR ScFv gene sequence, changing the human EGFR ScFv gene sequence, additionally arranging an enzyme cutting point Xba1 and BamH1 to the changed VH-L-VL gene sequence, arranging a protective basic group, and placing a histidine tag behind ATG, placing three end codons in the enzyme cutting point of the end 5minute. By adopting the human EGFR ScFv tobacco codon preference gene sequence, the human anti-mouse antibody reaction of mouse-sourced gene sequence in the human body and other adverse reactions caused by other sourced gene sequences can be avoided. The human EGFR ScFv effectively expressed by utilizing a plant biological reactor of the tobacco has an antitumor effect.

Description

technical field [0001] The invention belongs to the field of using a plant bioreactor to produce an antitumor drug, in particular to a fully human EGFR ScFv tobacco codon preference gene sequence and its obtaining method and application. Background technique [0002] At present, the use of chemotherapy to treat cancer has become a routine treatment method, but chemotherapy has its application bottleneck. Now there is an urgent need for another medical method to break through the bottleneck of chemotherapy. Cancer biotherapy has become the fourth method after the three classic tumor treatment methods of surgery, chemotherapy and radiotherapy. Epidermal growth factor receptor (EGFR) is a multifunctional glycoprotein widely distributed on cell membranes of various tissues in the human body. Abnormal expression of EGFR can lead to continuous activation of cell signaling pathways and eventually lead to tumorigenesis (non-patent literature 1). EGFR is a tyrosine protein kinase r...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N15/13C12N15/10C07K16/30A61P35/00
Inventor 郭尚敬李素芬张付雷李妹芳冀芦沙
Owner LIAOCHENG UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products