Human vascular endothelial growth factor specifically-binding antibody or antigen-binding fragment and application thereof
A technology that combines fragments and vascular endothelium, applied in the field of biomedicine, can solve problems such as antibodies that need to be improved
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0042] Example 1 Preparation and Screening of Mouse Monoclonal Antibody
[0043] (1) Immunization of mice
[0044] HuVEGF 165 The amino acid sequence is:
[0045] MGWSCIILFLVATGVHSAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRHHHHHH
[0046] huVEGF 165 The protein was dissolved in 1×PBS to obtain a protein solution. An appropriate amount of protein solution was taken, mixed and emulsified with complete Freund's adjuvant (Sigma), and 8-week-old BALB / c female mice were taken, and the antigen was injected subcutaneously at multiple points. Two weeks later, an appropriate amount of protein solution was mixed and emulsified with incomplete Freund's adjuvant (Sigma), and subcutaneously administered to the mice for the second immunization. Thereafter, the third and fourth immunizations were carried out every 3 weeks. Three days after the fourth immunization, sp...
Embodiment 2
[0066] Embodiment 2 Mouse monoclonal antibody characteristic determination
[0067] 1) Determination of the relative affinity of monoclonal antibodies by indirect ELISA
[0068] Coat the microtiter plate with 0.5 μg / ml huVEGF standard, 100 μl per well. Incubate at 37°C for 2 hours, wash with PBS containing 1% Tween-20, and block for 2 hours. The monoclonal antibody NevegiMab was diluted threefold with an initial concentration of 1 μg / ml, and commercialized bevacizumab (avastin) was used as a comparison, and incubated at 37 degrees Celsius for 1 hour. After 5 washes, 100 μl of HRP-labeled corresponding secondary antibodies were added and incubated at 37°C for 1 hour. After 5 washes, add 50 μl of chromogenic solution, incubate at 37°C for 15 minutes, stop the reaction with 50 μl of 2M sulfuric acid, OD 450 reading.
[0069] After four-parameter fitting (OriginPro8), the EC of NevegiMab 50 20pM, EC of Avastin 50 is 190pM. EC 50 The value refers to the concentration of hal...
Embodiment 3
[0089] Example 3 Activity Research of Mouse Monoclonal Antibody
[0090] 1) HuVEC proliferation consistent method to determine the ability of antibodies to antagonize the biological activity of VEGF
[0091] Human umbilical vein endothelial cells (HuVEC) in good growth state were taken, and the cell concentration was adjusted to 5×10 4 / ml, inoculated in 96-well cell culture plate, 100 μl / well, cultured in the incubator for 24 hours, changed the medium with 0.5% serum content, continued to cultivate for 72 hours, added VEGF antibodies with different concentration gradients, and took 3 for each concentration Parallel wells, add huVEGF at a final concentration of 100ng / ml 165 , After culturing for 24 hours, it was detected with a chemiluminescence kit. The results are attached Figure 4 shown.
[0092] as attached Figure 4 As shown, the lower the Lum reading, the more obvious the inhibition of cell proliferation by the monoclonal antibody. The results showed that at the s...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com
