Unlock instant, AI-driven research and patent intelligence for your innovation.

Serpin fusion polypeptides and methods of use thereof

A serine protease, inhibitor technology, applied in the molecular field, can solve problems such as increasing the risk of infection

Inactive Publication Date: 2017-09-26
INHIBRX INC
View PDF8 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In addition, serpin proteins have demonstrated anti-infective activity, while targeting inflammatory cytokines has been shown to increase infection risk

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Serpin fusion polypeptides and methods of use thereof
  • Serpin fusion polypeptides and methods of use thereof
  • Serpin fusion polypeptides and methods of use thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0369] Example 1: AAT-Fc fusion proteins and variants

[0370] Illustrative, non-limiting examples of AAT-Fc fusion proteins according to the present invention include the following sequences. Although these examples include hinge and / or linker sequences, fusion proteins of the invention can be prepared using any hinge and / or linker sequence of suitable length and / or flexibility. Alternatively, fusion proteins can be prepared without the use of hinge and / or linker sequences. For example, polypeptide components can be linked directly.

[0371] An exemplary AAT-Fc fusion protein is AAT-hFc1 (human IgG1 Fc) described herein. As shown below, the AAT polypeptide portion of the fusion protein is underlined (SEQ ID NO: 2) and the IgG-Fc polypeptide portion of the fusion protein is italicized (SEQ ID NO: 3).

[0372] AAT-hFc1 (Human IgG1 Fc)

[0373] EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTH DEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLV...

Embodiment 2

[0402] Example 2: AAT-TNFα targeting molecule fusion protein

[0403] The studies provided herein describe several non-limiting examples of recombinant AAT derivatives comprising human AAT fused to an anti-TNFα antibody or a TNFα receptor derivative. These examples are provided below to further illustrate the different features of the invention. The examples also illustrate useful methods for practicing the invention. These examples are not limiting, nor are they intended to limit the scope of the invention.

[0404] The fusion proteins below include cytokine-targeting polypeptide sequences from or derived from (i) the anti-TNFα antibody D2E7 (also known as Adalimumab or Humira®) or (ii) the extracellular domain of the type 2 TNFα receptor ( TNFR2-ECD). The AAT polypeptide portion of the fusion protein is underlined, the antibody constant region (CH1-hinge-CH2-CH3, or CL) is italicized, and D2E7-VH, D2E7-VK, and TNFR2-ECD are bolded. Although these examples include hinge a...

Embodiment 3

[0429] Example 3 AAT-Fc-SLPI and AAT-Fc-Elastase Inhibitor

[0430] The studies presented herein describe several non-limiting examples of recombinant AAT derivatives comprising human AAT fused to a WAP domain-containing protein. These examples are provided below to further illustrate the different features of the invention. The examples also illustrate useful methods for practicing the invention. The AAT polypeptide portion of the fusion protein is underlined, the Fc portion is italicized, and the WAP domain-containing polypeptide is bolded. Although these examples include hinge and / or linker sequences, fusion proteins of the invention can be prepared using any hinge and / or linker sequence of suitable length and / or flexibility. Alternatively, fusion proteins can be prepared without the use of hinge and / or linker sequences. For example, polypeptide components can be linked directly.

[0431] An exemplary AAT-Fc-SLPI fusion protein is AAT-hFc1-SLPI (human IgG1 Fc) described...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

This invention relates to molecules, particularly polypeptides, more particularly fusion proteins that include a serpin polypeptide or an amino acid sequence that is derived from a serpin and second polypeptide comprising of at least one the following: an Fc polypeptide or an amino acid sequence that is derived from an Fc polypeptide; a cytokine targeting polypeptide or a sequence derived from a cytokine targeting polypeptide; a WAP domain containing polypeptide or a sequence derived from a WAP containing polypeptide; and an albumin polypeptide or an amino acid sequence that is derived from a serum albumin polypeptide. This invention also relates to methods of using such molecules in a variety of therapeutic and diagnostic indications, as well as methods of producing such molecules.

Description

[0001] related application [0002] This application claims the benefit of US Patent Application No. 14 / 524,832, filed October 27, 2014, the contents of which are hereby incorporated by reference in their entirety. [0003] Incorporation of Sequence Listings [0004] The contents of the text file named "INHI002002WO_SeqList.txt", created on October 26, 2015 and 228 KB in size, are hereby incorporated by reference in their entirety. field of invention [0005] The present invention relates to molecules, particularly polypeptides, more particularly fusion proteins, comprising a serpin polypeptide or an amino acid sequence derived from a serpin polypeptide and a second polypeptide. In addition, the present invention relates to fusion proteins comprising a serpin polypeptide or an amino acid sequence derived from a serpin polypeptide, a second polypeptide and a third polypeptide. In particular, the present invention relates to fusion proteins comprising at least one serpin polyp...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A61P37/00C07K16/00
CPCC07K16/241C07K2317/21C07K2317/52C07K2317/76C07K2319/30C07K2319/31C07K2319/70C07K14/8121C07K2319/00A61P1/04A61P11/00A61P11/06A61P17/02A61P17/06A61P19/02A61P25/00A61P29/00A61P31/00A61P31/04A61P31/10A61P31/12A61P35/00A61P37/00A61P37/02A61P37/06A61P7/00A61P9/10A61P3/10A61K38/55C07K19/00A61K47/6803A61K47/6845C07K14/7155
Inventor B.P.埃克尔曼J.C.蒂默Q.德夫劳克瓦
Owner INHIBRX INC