Serpin fusion polypeptides and methods of use thereof
A serine protease, inhibitor technology, applied in the molecular field, can solve problems such as increasing the risk of infection
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0369] Example 1: AAT-Fc fusion proteins and variants
[0370] Illustrative, non-limiting examples of AAT-Fc fusion proteins according to the present invention include the following sequences. Although these examples include hinge and / or linker sequences, fusion proteins of the invention can be prepared using any hinge and / or linker sequence of suitable length and / or flexibility. Alternatively, fusion proteins can be prepared without the use of hinge and / or linker sequences. For example, polypeptide components can be linked directly.
[0371] An exemplary AAT-Fc fusion protein is AAT-hFc1 (human IgG1 Fc) described herein. As shown below, the AAT polypeptide portion of the fusion protein is underlined (SEQ ID NO: 2) and the IgG-Fc polypeptide portion of the fusion protein is italicized (SEQ ID NO: 3).
[0372] AAT-hFc1 (Human IgG1 Fc)
[0373] EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTH DEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLV...
Embodiment 2
[0402] Example 2: AAT-TNFα targeting molecule fusion protein
[0403] The studies provided herein describe several non-limiting examples of recombinant AAT derivatives comprising human AAT fused to an anti-TNFα antibody or a TNFα receptor derivative. These examples are provided below to further illustrate the different features of the invention. The examples also illustrate useful methods for practicing the invention. These examples are not limiting, nor are they intended to limit the scope of the invention.
[0404] The fusion proteins below include cytokine-targeting polypeptide sequences from or derived from (i) the anti-TNFα antibody D2E7 (also known as Adalimumab or Humira®) or (ii) the extracellular domain of the type 2 TNFα receptor ( TNFR2-ECD). The AAT polypeptide portion of the fusion protein is underlined, the antibody constant region (CH1-hinge-CH2-CH3, or CL) is italicized, and D2E7-VH, D2E7-VK, and TNFR2-ECD are bolded. Although these examples include hinge a...
Embodiment 3
[0429] Example 3 AAT-Fc-SLPI and AAT-Fc-Elastase Inhibitor
[0430] The studies presented herein describe several non-limiting examples of recombinant AAT derivatives comprising human AAT fused to a WAP domain-containing protein. These examples are provided below to further illustrate the different features of the invention. The examples also illustrate useful methods for practicing the invention. The AAT polypeptide portion of the fusion protein is underlined, the Fc portion is italicized, and the WAP domain-containing polypeptide is bolded. Although these examples include hinge and / or linker sequences, fusion proteins of the invention can be prepared using any hinge and / or linker sequence of suitable length and / or flexibility. Alternatively, fusion proteins can be prepared without the use of hinge and / or linker sequences. For example, polypeptide components can be linked directly.
[0431] An exemplary AAT-Fc-SLPI fusion protein is AAT-hFc1-SLPI (human IgG1 Fc) described...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


