Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A kind of cool and sweat-absorbing summer clothing fabric

A fabric and clothing technology, applied in the field of cool and sweat-absorbing summer clothing fabrics, can solve the problems of being unsuitable for ordinary clothing, insufficient softness of the fabric, and narrow application range, etc., and achieve excellent moisture absorption and moisture conduction performance, good anti-wrinkle effect, and convenient operation and control Effect

Active Publication Date: 2019-03-29
山东恒利纺织科技有限公司
View PDF1 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The finished fabric has the characteristics of super moisture absorption and quick drying, antistatic, radiation protection, stable size, washing resistance, comfortable wearing, cool, etc. It can be used for medical summer professional clothing, but the fabric is not soft enough, so it is not suitable for summer Ordinary clothing, narrow application range

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0015] A cool and sweat-absorbing summer clothing fabric. The production method includes preparation of modified bamboo fiber, preparation of blended yarn, preparation of base fabric, heat setting, preparation of finishing liquid, and finishing. The specific steps are:

[0016] 1) Preparation of modified bamboo fiber: Bamboo fiber is impregnated with a Teflon solution with a concentration of 22g / L. The Teflon solution contains an active polypeptide with a weight fraction of 0.035wt%, and the bath ratio is 1:42. 73%, dehydrated, dried at 98°C for 23 minutes, then baked at 110°C for 5 minutes, the amino acid sequence of the active polypeptide is HSHACKLCVCVNCFCCGCYLCRVLHPGKLCCSK, one end of the active polypeptide is a hydrophilic group, which can destroy the cell wall in bamboo fiber , change the osmotic pressure of the bamboo fiber, promote the Teflon solution to enter the fiber, modify the fiber, and have no toxic side effects, no skin irritation, and no pollution to the enviro...

Embodiment 2

[0023] A cool and sweat-absorbing summer clothing fabric. The production method includes preparation of modified bamboo fiber, preparation of blended yarn, preparation of base fabric, heat setting, preparation of finishing liquid, and finishing. The specific steps are:

[0024] 1) Preparation of modified bamboo fiber: Bamboo fiber is impregnated with a Teflon solution with a concentration of 20g / L. The Teflon solution contains an active polypeptide with a weight fraction of 0.05wt%, and the bath ratio is 1:42. 76%, dehydrated, dried at 98°C for 22 minutes, then baked at 108°C for 6 minutes, the amino acid sequence of the active polypeptide is HSHACKLCVCVNCFCCGCYLCRVLHPGKLCVCNCSK, one end of the active polypeptide is a hydrophilic group, which can destroy the cell wall in bamboo fiber , change the osmotic pressure of the bamboo fiber, promote the Teflon solution to enter the fiber, modify the fiber, and have no toxic side effects, no skin irritation, and no pollution to the enviro...

Embodiment 3

[0031] Performance test of cool and sweat-absorbing summer clothing fabrics:

[0032] The fabrics of Example 1 and Example 2 were set as the test group, and common commercially available fabrics were set as the control group, and the cool and refreshing feeling test and the sweat absorption test were carried out respectively.

[0033] Cooling feeling test: The contact cooling and warming feeling tester takes the instant cooling feeling Q-max as an indicator: the degree of cooling feeling is calculated by simulating the change of heat generated after the hand touches the fabric, and the calculation results are shown in Table 1.

[0034] Sweat absorption test: refer to "GB / T 14576-2009 Textile Color Fastness Test Light Fastness, Sweat Composite Color Fastness" to prepare sweat, put the fabric to be tested in sweat and completely wet it for 5 minutes, take it out and hang it naturally, when two drops of water fall When the time interval exceeds 30s, it can be considered that the ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a cool sweat-absorbing summer clothing fabric. The fabric is formed by interweaving warp and weft in a one-up one-down plain weave, honeycomb micro-pore modified polyester / jade fiber / viscose blended yarn is adopted as the warp, modified bamboo fiber / hemp fiber / soy protein fiber blended yarn is adopted as the weft, and the fabric is prepared after heat setting and wrinkle-resistant softening post-finishing. The cool sweat-absorbing summer clothing fabric has the advantages that the fabric has excellent sweat-absorbing property and excellent breathability, can effectively control the adhesion feel caused by sweating from exercises, and has a good cool sense, anti-bacterial property and anti-ultraviolet property; the fabric is good in anti-wrinkling effect and easy to color, has a smooth soft hand feel and wash durability, and has a good wearing comfort, so that it is healthier for people to wear; it is not necessary to consider contraction after cloth cutting, sewing and ironing, the fabric is easy to produce, simple in processing technology, easy to operate and control, stable in quality, high in production efficiency, and easy for large-scale industrialized production.

Description

technical field [0001] The invention relates to the field of clothing fabrics, in particular to a cool and sweat-absorbing summer clothing fabric. Background technique [0002] The human body is an open, highly adaptable body system. When the environment changes, the fastest adaptive response of the human body is the change of the circulatory system, which carries the heat generated in the body to the skin and increases heat dissipation through sweating and evaporation. If sweat cannot be effectively transmitted and evaporated, a large amount of heat will accumulate in the body, which will affect the comfort of the human body, and may also cause fatigue and trembling reactions due to excessive body temperature, and even reduce the body's ability to exercise. The human body has been losing water through gaseous sweat, which is very important to maintain the body's thermal balance and comfort. This process depends on the state of the human body and the surrounding climate env...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): D02G3/44D02G3/04D03D15/00D06C7/02D06M15/256D06M13/463D06M13/432D06M15/564D06M101/06D06M101/32D06M101/04
CPCD02G3/04D02G3/441D02G3/449D06C7/02D06M13/432D06M13/463D06M15/256D06M15/564D06M2101/04D06M2101/06D06M2101/32D10B2101/02D10B2201/01D10B2201/10D10B2201/24D10B2211/26D10B2331/04D03D15/47
Inventor 应杰
Owner 山东恒利纺织科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com