Supercharge Your Innovation With Domain-Expert AI Agents!

Leucocyte immunoglobulin-like receptor neutralizing antibodies

A technology of cytotoxicity and antibodies, applied in the direction of immunoglobulin, anti-animal/human immunoglobulin, anti-receptor/cell surface antigen/cell surface determinant immunoglobulin, etc., can solve unmet problems

Pending Publication Date: 2021-08-31
INNATE PHARMA SA
View PDF13 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

As localized and metastatic cancers remain the deadliest of all urinary tract malignancies, there is a largely unmet need for significant improvements in the treatment of the disease

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Leucocyte immunoglobulin-like receptor neutralizing antibodies
  • Leucocyte immunoglobulin-like receptor neutralizing antibodies
  • Leucocyte immunoglobulin-like receptor neutralizing antibodies

Examples

Experimental program
Comparison scheme
Effect test

example 1

[0313] Example 1: ILT2 (LILRB1) in healthy human donor and memory CD8 T cells expressed the CD56 dim NK cells

[0314] LILRB1 determined expression on peripheral blood mononuclear cells by fresh whole blood from healthy human donors were subjected to flow cytometry. NK group was determined to be CD3-CD56 + cells (anti-CD3 AF700- biological legendary company (BioLegend) # 300424; anti-CD56 BV421-BD Biosciences (BD Biosciences) # 740076). In NK cells, CD56 bright subsets were identified as CD16- cells and CD56 dim subsets were identified as CD16 + cells (anti CD16BV650-BD Biosciences # 563691). CD4 + and CD8 + T cells were identified as CD3 + CD56-CD4 + and CD3 + CD56-CD8 + cells (CD3- supra; CD4 BV510-BD Biosciences # 740161; CD8BUV737-BD Biosciences # 564629). In CD4 + T cell population, Tconv and Treg were identified as CD127 + CD25- / low CD127 CD25 high and low cells (CD127 PE-Cy7-BD Biosciences # 560822; CD25VioBright- Miltenyi Biotech (Miltenyi Biotec) # 130-104-274). In CD8 ...

example 2

[0317] Examples 2: ILT2 is upregulated in many human cancers

[0318] Determined by monocytes purified from whole blood of a human cancer patient donor peripheral blood mononuclear cells (PBMC) for flow cytometry, B cells, CD4 + T cells, CD8 + T cells and CD16- and CD16 + ILT2 on NK cells, express both. Using the same antibody as detailed in Example 1 a mixture of cell populations to identify and assess ILT2 expression. PBMC were incubated with the antibody mixture was incubated in the dark at 4 ℃ together for 20 minutes, washed twice in staining buffer, fluorescence was measured by flow cytometry on Fortessa.

[0319] Results from a sample of a cancer patient is shown in FIG. As can be seen, ILT2 again is expressed on all B cells and monocytes. However, in lymphocyte subsets, NK cells and CD8 T cells, on the cell of ILT2 from three types of cancer (HNSCC, NSCLC and RCC) more frequently (statistically significant) is expressed. ILT2 also up-regulated in ovarian cancer, the patient...

example 3

[0320] Example 3: generating an anti-antibody ILT2

[0321] Materials and Methods

[0322] ILT-2_6xHis clone and produce recombinant proteins

[0323] ILT-2 protein (the Uniprot accession number Q8NHL6) between NruI restriction site and BamHI restriction site was cloned into the vector pTT-5. Use of the heavy chain leader peptide. PCR was performed using the following primers:

[0324] ILT-2_ Forward _ACAGGCGTGCATTCGGGGCACCTCCCCAAGCCCAC (SEQ ID NO: 57)

[0325] ILT-2_ reverse _CGAGGTCGGGGGATCCTCAATGGTGGTGATGATGGTGGTGCCTTCCCAGACCACTCTG (SEQ ID NO: 58)

[0326] Added 6xHis tag at the C-terminal portion of the protein for purification. Transfected with the vector generated EXPI293 cell lines for transient production. Protein was purified from the supernatant using Ni-NTA beads, and purified using SEC monomer.

[0327] The amino acid sequence of ILT-2_6xHis recombinant protein as follows:

[0328] GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESS...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

This invention relates to agents that bind and neutralize the inhibitory activity of human ILT2 proteins having inhibitory activity in NK cells, T cells and / or other immune cells. Such agents can be used for the treatment of cancers or infectious disease.

Description

[0001] Cross-reference [0002] 62] This application claims the rights December 26, 2018 filed U.S. Provisional Application / No. 784,862, the U.S. provisional application is incorporated in its entirety by reference herein; contains any reference. [0003] Sequence list reference [0004] This application is submitted with the Sequence Listing in electronic format. Sequence Listing size of 20 December 2019 created 178KB to "LILRB1_ST25" named file is provided. Information in the electronic format of the Sequence Listing is incorporated herein by reference. Technical field [0005] The present invention relates to binding NK cells, T cells, monocytes, macrophages and / or other immune cells have inhibitory activity in human ILT2 and protein and an agent that inhibits the activity of such proteins ILT2. Such agents can be used to treat cancer or infectious diseases. Background technique [0006] Ig-like transcript (ILT) also referred to as a corresponding receptor or inhibiting l...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K16/28A61K39/395A61P35/00
CPCC07K16/2803C07K2317/52C07K2317/71C07K2317/76C07K2317/92C07K2317/73C07K2317/34A61K2039/507C07K16/2863C07K16/2887C07K2317/732A61P35/00A61K2039/505C07K16/30C07K2317/565C07K2317/21C07K2317/24C07K2317/41C07K2317/56
Inventor O·贝纳克S·尚特克斯I·普罗特B·罗西N·维奥
Owner INNATE PHARMA SA
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com