Unlock instant, AI-driven research and patent intelligence for your innovation.

Application of CTRP13 in preparation of medicine for preventing and treating vascular and tumor diseases

A drug and disease technology, applied in the application field of CTRP13, can solve the problem that the effect of anti-tumor angiogenesis drugs needs to be improved and so on

Pending Publication Date: 2022-03-18
XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
View PDF1 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0007] In view of the above problems, the present invention provides the use of CTRP13 in the preparation of drugs for the prevention and treatment of blood vessels and tumor diseases, which mainly solves the problems of CTRP13 in the application of anti-tumor drugs, and the effect of existing anti-tumor angiogenesis drugs needs to be improved, and also makes up for some problems. Basic body mechanism regulation preparation blank

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of CTRP13 in preparation of medicine for preventing and treating vascular and tumor diseases
  • Application of CTRP13 in preparation of medicine for preventing and treating vascular and tumor diseases
  • Application of CTRP13 in preparation of medicine for preventing and treating vascular and tumor diseases

Examples

Experimental program
Comparison scheme
Effect test

experiment example 1

[0058] figure 1 Middle A is an 8-week-old male C57BL / 6 mouse, which was given control (Vehicle) and CTRP13-expressing adenovirus (CTRP13) respectively, injected into the tail vein of the mouse, and then the tumor cell suspension was subcutaneously inoculated on the back of the mouse. The size of the solid tumor was measured on the fifth day, ninth day, fourteenth day and sixteenth day after inoculation. figure 1 Middle B is the statistical chart of the change of tumor size in mice in A.

[0059] Depend on figure 1 In A and B, it can be seen that compared with the control treatment group, on the ninth day, fourteenth day, and sixteenth day after inoculation, the solid tumor volume of mice in the overexpression CTRP13 group decreased significantly, and overexpression CTRP13 inhibited the tumor growth.

[0060] Depend on figure 1 Middle C shows that the comparative effects of inhibiting CTRP13 and bevacizumab and sorafenib have been significantly improved.

experiment example 2

[0062] Eight-week-old male C57BL / 6 mice were given control (Vehicle) and CTRP13-overexpressed adenovirus (CTRP13) and subcutaneously inoculated tumors. The mice were sacrificed on the 16th day after inoculation, and the tumor tissues of the mice were collected and analyzed by immunofluorescence Technology detection of CD31 protein expression level.

[0063] figure 2 B is the immunofluorescence graph, CD31 protein expression, and related expression statistical graphs;

[0064] Depend on figure 2 It can be seen from the above results that the protein expression level of CD31 in tumor tissue was significantly decreased in subcutaneously transplanted tumors overexpressing CTRP13 group.

experiment example 3

[0066] After HUVEC cells were treated with solvent control, CTRP13, solvent control and adenovirus overexpressed CTRP13, the proliferation of HUVEC was detected by EdU assay.

[0067] image 3 Middle A is the solvent control group (Vehicle group) and CTRP13 treatment group (100ng / ml) using EdU assay to detect the proliferation of human umbilical vein endothelial cells (HUVEC). The first column is the solvent control group (Vehicle group), and the second column is the CTRP13 treatment group (CTRP13).

[0068] image 3 Middle B is the statistical graph of HUVEC proliferation detected by EdU experiment in solvent control group (Vehicle group) and CTRP13 treatment group (CTRP13).

[0069] Depend on image 3 In A and B, it can be seen that overexpression of CTRP13 inhibits the proliferation of HUVEC cells.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to research in the application field of CTRP13, and particularly relates to application of CTRP13 in preparation of drugs for preventing and treating vascular and tumor diseases. Mainly discloses application of CTRP13 in preparation of drugs for inhibiting angiogenesis. In the application, the application is the application of the CTRP13 in preparation of anti-tumor angiogenesis drugs. The invention relates to an application of CTRP13 in preparation of a preparation for inhibiting activation of an angiogenesis signal transduction pathway. The invention relates to an application of CTRP13 in preparation of a preparation for inhibiting a VEGFR2 molecular signal channel. The invention relates to an application of CTRP13 in preparation of a medicine for promoting HUVEC cell proliferation and / or HUVEC cell migration. In the application, in some ways, the CTRP13 is a CTRP13 protein or a CTRP13 gene overexpression molecule. The invention relates to application of CTRP13 in preparation of a medicine for preventing and treating subretinal angiogenesis diseases. The CTRP13 has an inhibition effect on a VEGFR2 (vascular endothelial growth factor receptor 2) signal channel, and can become a new target spot for resisting tumor angiogenesis, so that occurrence and development of tumors are prevented or treated; the CTRP13 can also be applied as a medicine for treating endothelial cells participating in diseases such as retinal angiogenesis, vascular injury and the like.

Description

technical field [0001] The invention belongs to the research on the application field of CTRP13, and in particular relates to the use of CTRP13 in the preparation of medicines for preventing and treating blood vessel and tumor diseases. Background technique [0002] Human C1q tumor necrosis factor-related protein 13, the English name is CTRP13, and its alias is Complement C1qLike 3; C1q And Tumor Necrosis Factor-Related Protein 13; Complement Component1, Q Subcomponent-Like 3; Complement C1q-Like Protein 3; contains 255 amino acids , and its molecular weight is 26719Da. NCBI reference sequence number: NP_001010908.1, the amino acid sequence is as follows: [0003] MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD。 [0004] In recent years, members of the complement C1q / T...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A61K38/19A61P35/00A61P9/10
CPCA61K38/191A61P35/00A61P9/10
Inventor 黄恺王成陈敏梁明露
Owner XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV