440 results about "Cell migration" patented technology

The invention provides humanized recombinant XVII collagen for promoting hair follicle stem cell repair and resisting aging as well as a preparation method and application thereof, and belongs to the technical field of biological medicines. The humanized recombinant XVII type collagen comprises polypeptide derived from the XVII type collagen or repeated protein formed by N times of repeated series connection of the polypeptide serving as a unit, n is an integer from 2 to 4; the polypeptide derived from the XVII type collagen comprises a polypeptide A and / or a polypeptide B; the amino acid sequence of the A polypeptide is as shown in SEQ ID NO: 1; and the amino acid sequence of the B polypeptide is as shown in SEQ ID NO: 2. The humanized recombinant XVII type collagen not only can be massively and stably recombined and expressed, but also has cell adhesion activity, cell proliferation promotion activity, cell migration promotion activity and excellent hair follicle repair and regeneration promotion activity, and has no sensitization side effect. The invention provides a new way for preparing collagen products with rich functions.

The present invention relates to the field of biomedicine and discloses a platelet-rich plasma for anti-aging and promoting tissue repair and regeneration, a preparation method, and an application thereof, comprising the following steps: obtaining concentrated platelet plasma, and treating the concentrated platelet plasma with low-intensity pulsed ultrasound; the treatment conditions are one of the following treatment methods: 1) the treatment power is 2 to 5 W / cm 2 , the pulse period is 50%, and the ultrasonic treatment time is 2~10 min; 2) First, the first ultrasonic treatment is performed: using 0.2~1.0 W / cm 2 , the pulse period is 50%, ultrasonic treatment is 1~5 min; then the second ultrasonic treatment is carried out: 1.5~5.0 W / cm 2 , the pulse period is 50%, and the ultrasonic treatment is 1 to 5 minutes; the present invention adopts a special ultrasonic treatment system to obtain a PRR product with special activation and lysis characteristics. The product has active substances that are beneficial to tissue repair and regeneration and anti-aging, and shows excellent effects in promoting cell proliferation, cell migration and wound healing.

The present invention relates to a recombinant human type IV collagen and a preparation method therefor, which belong to the technical field of bioengineering. A recombinant human type IV collagen is designed on the basis of a partial sequence in an α2 chain of human type-IV collagen, and DNA encoding of the protein is ligated into an expression vector to construct a recombinant expression vector; then the recombinant expression vector is transformed into competent Escherichia coli cells, and a recombinant expression plasmid is extracted; after the plasmid is linearized, the linearized plasmid is transformed into an engineered strain HCPB-PPKEX2 to obtain a recombinant engineered strain; and the engineered strain is cultured, the expression of a target protein is induced, and the target protein is purified and identified. It is further demonstrated experimentally that the collagen can be completely cleaved by Kex2, Ste13 and CPB enzymes and efficiently secreted and expressed extracellularly, and the obtained sequence is completely consistent with a theoretical sequence. It is also verified experimentally that the recombinant collagen has a cell adhesion activity and a cell migration-promoting activity. The method avoids the risk of residual exogenous proteins, shortens the time and reduces the cost of the subsequent purification process, and thus has a relatively high safety and application value.

The present invention belongs to the technical field of protein engineering. Provided are a recombinant type XVII collagen having a triple helix structure and the use thereof. The amino acid sequence of the recombinant type XVII collagen comprises n core units, wherein n is the integer 1 or an integer greater than 1, and the amino acid sequence of the core units is as shown in SEQ ID NO: 1. Further provided are a method for constructing a plurality of expression systems and a method for preparing the recombinant type XVII collagen. Further provided is the actual industrial application on the basis of the characteristics of the protein. The provided recombinant type XVII collagen exhibits high purity, good thermal stability and high biological activity, and has a molecular weight much smaller than that of natural collagen, thereby reducing the difficulty for the collagen to cross the skin barrier and exert biological functions. Experiments show that the recombinant type XVII collagen has a variety of biological activities such as promoting cell migration.

The invention relates to the technical field of biological medicine, in particular to eye drops containing recombinant protein as well as a preparation method and application of the eye drops. Comprising the following components: 0.01%-1% of recombinant human TFF3 protein, 0.1%-1% of an osmotic pressure regulator, 0.08%-2% of a pH regulator, 0.05%-0.15% of a thickening agent, 0.01%-0.1% of a surfactant, 0.01%-0.1% of a protective agent and the balance of water for injection, the traditional Chinese medicine composition can be used for treating the xerophthalmia, can promote wound healing and cell migration, has the effects of inhibiting inflammation and cell apoptosis, and can act on a plurality of target spots at the same time, so that the tear film stability is improved, ocular surface inflammation is inhibited, the vicious circle of the xerophthalmia is broken, and the xerophthalmia is treated more comprehensively and effectively; the problems that in the prior art, xerophthalmia medicine targets are single, and xerophthalmia cannot be comprehensively and effectively treated are solved.

The invention provides a preparation method and application of a camellia polypeptide composition with anti-wrinkle, repairing and brightening effects. The camellia polypeptide composition comprises a component A and a component B, wherein the component A comprises a wrapping solubilizer and polyhydric alcohol; component B: a plurality of polypeptides; the component C comprises carnosine, camellia polypeptide and water. The camellia polypeptide disclosed by the invention is prepared by the following steps: performing supercritical deoiling on camellia seeds, performing alkali extraction, acid precipitation and enzymolysis to prepare polypeptide, performing membrane filtration, taking micromolecule polypeptide as a main component, promoting synthesis of type I, type III and type V collagen, promoting cell migration and scavenging free radicals, and has the effects of resisting wrinkles, repairing and resisting oxidation; according to the invention, the problem of water solubility of palmitoyl peptide and acetyl peptide is solved, so that palmitoyl peptide and acetyl peptide can form a stable composition together with water-soluble polypeptide. The anti-wrinkle, repairing and whitening effects are achieved in multiple ways and multiple directions, the effects of improving wrinkles, repairing the skin, brightening the skin color and delaying senescence can be better achieved, and the anti-wrinkle, repairing and whitening composition can be widely applied to various types of cosmetics.

The present invention relates to the field of biomedical materials, particularly to a novel composite collagen material for wound repair, and more specifically to a method for preparing a novel composite collagen material comprising recombinant humanized collagen type 21 (ColpepA1 21) and its use in wound repair. The present invention utilizes ColpepA1 21 to significantly promote key biological reactions in the wound healing process, including accelerating cell migration, enhancing skin hydration and barrier function, and improving the stability and elasticity of skin structure. The resulting novel composite collagen material effectively promotes wound healing and cell regeneration, alleviating oxidative damage.

The present invention provides a yeast recombinant type XVII humanized collagen and its preparation method, in particular, a recombinant humanized collagen expressing the 15th helical region of type XVII collagen, a recombinant engineering bacterium and its preparation method, belonging to the technical fields of genetic engineering and synthetic biology. The present invention provides the full-length sequence of the 15th helical region of type XVII collagen, and mutants are obtained by mutating amino acid residues based on this sequence; for the first time, the present invention expresses the full-length sequence of the 15th helical region of type XVII collagen in Pichia pastoris, establishes a complete set of fermentation processes and purification processes, improves the protein expression level and reduces degradation, and through experiments, it is verified that the obtained protein has biological activities such as cell adhesion activity and cell migration promotion activity that reach or exceed those of natural human collagen, can achieve the purpose of real product application, and can be widely applied in the fields of medicine, medical devices, biological materials, tissue engineering, cosmetics, etc.

The invention discloses a recombinant human IV-type collagen as well as a preparation method and application thereof, and belongs to the field of bioengineering and protein engineering. According to the invention, three recombinant human IV type collagen new molecules are designed and screened on the basis of a part of sequences in a human IV type collagen alpha1 chain, soluble expression of a target protein is realized by using an escherichia coli system, and the recombinant collagen with the purity of more than 98% can be obtained through nickel column purification and acid regulation treatment. The recombinant collagen provided by the invention has good cell migration promotion activity and cell adhesion activity, and can be widely applied to the fields of tissue engineering, medical equipment, cosmetics, health care products and the like.

The invention provides recombinant IV type collagen and application thereof, and relates to the technical field of protein engineering. In the invention, an amino acid residue repetitive unit with good biological activity and stability in the human-derived IV-type collagen is found, and the amino acid residue repetitive unit is used as a core for repeating and constructing the recombinant IV-type collagen, so that the novel human-derived recombinant IV-type collagen with biological activity is obtained. The human-derived recombinant IV-type collagen provided by the invention is a small-molecular-weight protein, is easy to absorb by a human body, is good in safety, can remarkably promote secretion of collagen, also has the effects of promoting cell adhesion and cell migration, and has a good application prospect in the aspects of basement membrane repair and remodeling. A new functional component is provided for products for repairing and tightening the skin, resisting aging, resisting wrinkles, preserving moisture and the like.

The invention discloses an extracellular matrix fusion protein as well as a preparation method and application thereof, relates to the technical field of recombinant proteins, and aims to solve the technical problems that protein cosmetics in the market are relatively single in effect and difficult to meet application requirements. According to the extracellular matrix fusion protein, the nucleotide sequence of the extracellular matrix fusion protein is as shown in SEQ ID No.7. According to the extracellular matrix fusion protein with the nucleotide sequence shown as SEQ ID No.7, an in-vitro cell test proves that the fusion protein can remarkably promote cell adhesion, proliferation and cell migration, can act on a corium layer in a transdermal mode and remarkably promote collagen secretion, and due to the fact that recombinant protein belongs to biological protein, the fusion protein can be used for preparing the extracellular matrix fusion protein with the nucleotide sequence shown as SEQ ID No.7. Compared with common chemical cosmetics and hormone drugs, the composition has the advantages of easiness in decomposition, no residue and the like, and has a wider application prospect.

The invention discloses a preparation method and application of recombinant humanized III-type collagen, and belongs to the technical field of genetic engineering. According to the invention, three segments with good hydrophilicity and high solubility are screened from a humanized III-type collagen sequence through a bioinformatics method, and coding genes of the three segments are integrated into a pichia pastoris genome in a multi-copy form after being subjected to pichia pastoris codon preference optimization, so that a recombinant strain of the humanized III-type collagen is obtained. The recombinant strain secretes and expresses collagen, the purity can reach 95% or above only through one-step purification, the downstream separation and purification difficulty is obviously reduced, and the production process is easy to amplify. The prepared three recombinant human-derived III-type collagen proteins all have the activity of promoting cell migration and the activity of promoting cell proliferation, and have good application value.

The present invention belongs to the technical field of optimized coding gene, and discloses a recombinant human type I collagen, a preparation method thereof and an application thereof, and its amino acid sequence is shown as SEQ ID No.1. The recombinant type I collagen provided by the present invention has a high expression level, has better cell migration promotion, cell proliferation promotion and cell adhesion promotion properties, has high safety, and can be widely applied to fields such as medicine, medical devices, biological materials, tissue engineering, cosmetics and the like.

The invention provides a recombinant XVII type collagen fragment, and the protein fragment sequence of the recombinant XVII type collagen fragment is shown as SEQ ID No.1. The recombinant XVII type collagen fragment is screened and designed based on a natural collagen sequence, has a triple helix structure, has good biological activity, can effectively exert functions, and has a good promotion effect on cell migration, cell proliferation and cell adhesion. The method for preparing the recombinant XVII type collagen fragment has the advantages that the process steps are simplified, the expression efficiency of the recombinant protein is improved, and the production cost is reduced. The recombinant XVII type collagen fragment provided by the invention has good mechanical properties and biological activity, and can be used for preparing therapeutic drugs and biological materials.

The invention discloses an electroactive dressing used for promoting bone cell differentiation and bone regeneration and used for negative pressure therapy and a manufacturing method. The manufacturing method of the electroactive dressing comprises the steps that S1, a PLLA / BG spinning solution is prepared; s2, preparing a PLLA / BG nanofiber membrane through electrostatic spinning; s3, vacuum drying; s4, PAMAM-NH2 surface modification, the negative pressure treatment dressing relates to the technical field of negative pressure treatment dressings, when mechanical deformation is generated during negative pressure work, the piezoelectric biological film generates continuous electric stimulation, and the electric stimulation has positive and beneficial effects on osteoblasts and bone tissue physiological processes. The generated electric effect continuously collects functional electrolyte in surrounding tissues, and the functional electrolyte is separated in the wound by the dendrimer PAMAM-NH2, so that excessive exudation caused by negative pressure treatment is effectively made up. Meanwhile, the flow of the electrolyte further strengthens a local electric signal, so that cell migration and osteoblast proliferation and differentiation are effectively promoted.

The invention relates to the technical field of biological medicine, and discloses anti-aging and tissue repair and regeneration promoting platelet-rich plasma and a preparation method and application thereof.The preparation method comprises the following steps that concentrated platelet plasma is obtained, and low-intensity pulse ultrasound is adopted for treating the concentrated platelet plasma; the treatment conditions are one of the following treatment modes: 1) the treatment power is 2-5 W / cm < 2 >, the pulse period is 50%, and the ultrasonic treatment time is 2-10 min; (2) first ultrasonic treatment is carried out, specifically, 0.2-1.0 W / cm < 2 > is adopted, the pulse period is 50%, and ultrasonic treatment is carried out for 1-5 min; carrying out second ultrasonic treatment for 1-5 minutes by adopting 1.5-5.0 W / cm < 2 > and a pulse period of 50%; a special ultrasonic treatment system is adopted, the PRR product with special activation and lysis characteristics is obtained, and the product contains active substances beneficial to tissue repair and regeneration and anti-aging, and shows excellent effects in the aspects of promoting cell proliferation, cell migration and wound healing.

The invention belongs to the field of biological medicine and material science, and particularly relates to an intelligent response type piezoelectric nanofiber dressing and a preparation method and application thereof. According to the preparation method, polyvinylidene fluoride-trifluoroethylene, a high polymer material and inorganic nanoparticles are blended and spun through an electrostatic spinning technology, and then a photo-thermal component coating is subjected to surface in-situ oxidation and self-polymerization, so that the composite fiber membrane is prepared. Under the stimulation of ultrasound (US) and near-infrared laser (Laser), the fiber membrane can cooperatively activate the piezoelectric effect and the photothermal effect, generate a dynamic electric field and local high temperature, realize multi-mode cooperative killing of bacteria (the antibacterial rate exceeds 99%), and simulate an endogenous electric field to promote cell migration and wound healing. The dressing has good mechanical properties (the Young modulus is 15-20 MPa), hydrophilicity (the contact angle is about 30 degrees), biocompatibility and stability, is suitable for treatment of chronic infected wounds such as diabetes mellitus and the like, and has the advantages of on-demand activation and intelligent response.

A cholesterol oxidase-loaded biological material is a nanometer material and is characterized by comprising polyacrylic acid, cobalt oxyhydroxide and cholesterol oxidase, cobalt oxyhydroxide is adsorbed on polyacrylic acid to form a compound, and cholesterol oxidase is loaded on the compound. The size of the nano-biological material is about 100-150 nm, the nano-biological material is combined with ultrasound to obtain multiple nano-enzyme activities with enhanced effects and more excellent capabilities of generating active oxygen and relieving hypoxia, and a lipid raft structure on a cell membrane is damaged by the loaded cholesterol oxidase, so that cell migration is inhibited, and the effect of resisting tumor metastasis is achieved.

The invention discloses an application of Chinese yam derived exosome-like nanoparticles in preparation of skin injury repairing products, the exosome-like nanoparticles are derived from natural medicinal and edible plants, and have no cytotoxicity to skin keratinocytes HaCaT; scratch cell migration experiments are carried out, and it is found that healing can be rapidly promoted, and the anti-inflammatory effect is achieved. The invention further provides a preparation method of the Chinese yam-derived exosome-like nano-particles, Chinese yam tissue raw stock is separated through centrifugal treatment and sucrose gradient centrifugation, the high-purity exosome-like nano-particles are prepared, and the method is simple in technological process and easy to implement.

The invention discloses application of SHC3 as a diagnosis and prognosis marker and a treatment target of lung metastasis of breast cancer. The research shows that the expression of SHC3 in TNBC lung metastatic cells is remarkably up-regulated, and the up-regulation is closely related to the prognosis of TNBC patients; the increase of SHC3 expression is positively correlated with the migration ability of the TNBC cells, which proves that the SHC3 gene is obviously up-regulated in the TNBC cells of pneumophilic metastasis and can be used as a biomarker of lung metastasis of breast cancer; researches show that silence of SHC3 can significantly weaken the metastasis ability of TNBC and reduce the number of pulmonary metastasis nodules, overexpression of SHC3 can enhance the metastasis activity of TNBC, and SHC3 can be used as a therapeutic target of breast cancer pulmonary metastasis; the invention provides a new marker for prognosis of breast cancer and diagnosis of lung metastasis of breast cancer, and provides a new target and treatment strategy and direction for treatment of lung metastasis of breast cancer.

The invention relates to a phytoextraction external liniment for promoting black hair growth and a preparation method thereof. According to the liniment, a polygonum multiflorum extract, a cacumen biotae supercritical extract and molecular embedded black sesamin in a specific proportion are taken as cores and are matched with an azone-menthol transdermal enhancer and a propylene glycol-olive oil carrier, and black hair growth is synergistically promoted through triple mechanisms of activating tyrosinase, inhibiting melanocyte apoptosis and promoting cell migration. The preparation method adopts a gradient temperature extraction combined molecular embedding technology, the polygonum multiflorum is subjected to stepped purification at 40-60 DEG C-80 DEG C to retain thermosensitive active ingredients, the black sesamin is embedded by beta-cyclodextrin to improve the stability, and finally, the nano microemulsion is formed through two-stage homogeneous emulsification. The liniment can efficiently permeate into the deep layer of hair follicles, the efficiency of turning white hair into black is remarkably improved, and skin irritation is avoided.

The invention relates to a micro-fluidic chip integrated with a pneumatic micro valve, a preparation method and a use method. The micro-fluidic chip comprises an interface gas layer, a thin film layer and a fluid layer, the film layer is arranged between the interface gas layer and the fluid layer; the thin film layer is provided with a plurality of concentration gradient control channels, each concentration gradient control channel comprises a dilution inlet, a pneumatic micro-valve array, an observation area and an outlet which are connected in sequence, liquid enters the concentration gradient control channels through the dilution inlets, enters the flow channels provided with the pneumatic micro-valve arrays through the fishbone-shaped mixing micro-channels, and enters the flow channels through the fishbone-shaped mixing micro-channels; pneumatic micro valves in the pneumatic micro valve array are controlled through the interface gas layer so as to realize dynamic regulation and control of concentration gradients, and the fluid layer is used for accommodating dilution liquids with different concentration gradients; the observation area is used for observing diluted liquid in the fluid layer. The technical problem of real-time reconstruction of the concentration gradient of the micro-fluidic chip in the experiment process is solved, and the dynamic experiment requirements of scenes such as cell migration observation and drug time-varying response are met.

The invention relates to the field of biological dressings, and discloses an artificial dermis dressing as well as a preparation method and application thereof. The preparation method comprises the following steps: adding water into a container, and freezing until the water is frozen; then adding a collagen A solution, freezing and standing; continuing to add collagen B liquid, freezing and standing; continuing to add collagen A liquid, freezing and then freeze-drying; and cross-linking in a glutaraldehyde solution, and cleaning to obtain the artificial dermis dressing. The dressing provided by the invention can provide a good stent effect and promote cell migration and proliferation, and the healing rate is close to 100% after wound making. In the wound healing process, the dressing can inhibit collagen deposition, relieve inflammatory response, inhibit abnormal hyperplasia of blood vessels, inhibit excessive proliferation of fibroblasts and excessive formation of granulation tissues, and effectively prevent scar formation. The dressing can also effectively inhibit abnormal vascular hyperplasia in a wound area, and fibrosis and scar hyperplasia caused by excessive vascular hyperplasia are prevented.

The invention discloses a gel microneedle loaded with silver nanoparticles and a preparation method and application thereof.The extract nano-silver (AB-AgNPs) is prepared through a green synthesis strategy, a drug-loaded microneedle system is constructed based on carboxymethyl chitosan-vanillic aldehyde-polyvinyl alcohol (CMCS-Va-PVA) composite gel, the AB-AgNPs prepared through the technology are uniform in particle size and stable in dispersion, and the drug-loaded microneedle has the advantages that the drug-loaded microneedle is good in drug-loaded performance and good in drug-loaded performance; the crystal has a typical face-centered cubic crystal structure and metal state Ag0 characteristics; the gel microneedle has good mechanical strength and forming effect, the AB-AgNPs and the gel matrix are stably combined through hydrogen bonds, the chemical properties are kept unchanged, and the system has broad-spectrum efficient bacteriostatic activity and biocompatibility; an in-vitro experiment proves that the green synthesized gel microneedle loaded with the silver nanoparticles has a remarkable capability of promoting the healing of L929 cell tissues; a rat wound experiment proves that the gel microneedle can regulate and control an inflammatory factor network and promote cell migration and tissue regeneration, healing of common and infected wounds is remarkably accelerated, and the wound residue ratio in 9 days is as low as 2.7% and 10.9% respectively.

The invention discloses a preparation method and application of recombinant human-like collagen. The recombinant human-like collagen is fusion protein of collagen and elastin. The preparation method comprises the following steps: taking constructed escherichia coli engineering bacteria, inducing expression of human-like collagen through high-density fermentation, performing high-pressure homogeneous cell disruption after tubular centrifugal collection of fermented thalli, performing acid regulation, flocculating and settling of cell debris and host protein, and controlling pH and conductivity of feed liquid to obtain the human-like collagen. Through ion exchange chromatography purification and ultrafiltration concentration replacement, a human-like collagen stock solution with the liquid phase purity of more than 98% is obtained, and the total yield is more than 75%. Through cell biological activity detection and analysis, the purified human-like collagen has remarkable biological activity of promoting cell migration and adhesion. The whole preparation process developed by the invention is simple and convenient in process, high in yield, easy to amplify and suitable for industrial production of the recombinant human-like collagen, and the prepared protein raw material can be widely applied to the fields of medical beauty and biological medicine.

The invention provides a genetically engineered oriented electrostatic spinning fiber as well as a preparation method and application thereof, and belongs to the technical field of biomedical materials. Gene TSPAN9 is packaged in liposome through a micro-fluidic chip technology, then oriented electrostatic spinning fibers of a shell-core structure are prepared through an oriented micro-sol electrostatic spinning technology, and the liposome containing the TSPAN9 is protected on a core layer by hyaluronic acid; and the polylactic acid fibers are arranged in an oriented manner to form a shell layer. An in-vitro experiment shows that the oriented fiber closely simulates a fascia oriented arrangement structure, and the cell migration rate is remarkably improved through contact guidance; by slowly releasing lipidosome loaded with genes into cells and maintaining the mitochondrial steady state, mitochondrial respiration is effectively recovered, the active oxygen level is reduced, and the mitochondrial membrane potential function is maintained. In-vivo experiments show that the genetically engineered fiber can effectively inhibit inflammatory response and promote fascia tissue regeneration by promoting mitochondrial exocytosis to discharge damaged mitochondria.

The invention relates to the technical field of medical instruments, in particular to a photo-piezoelectric hydrogel dressing for wound repair. The hydrogel dressing realizes self-energized micro-electrical stimulation and anti-oxidation-antibacterial-anti-inflammatory integrated treatment through'energy-drug 'double closed-loop synergy: the PVDF / ZnO nanofiber on the upper layer can convert human body micro-motion and external light into micro-electrical stimulation to promote cell migration, proliferation and angiogenesis; the curcumin at the lower layer cooperates with the nano-silver to block the'oxidative stress-inflammation-infection 'vicious circle of chronic wounds. The dressing is soft and fit, does not need an external power supply, is excellent in biocompatibility, provides a self-driven multifunctional nursing scheme for refractory wounds, and has wide clinical popularization and market application prospects.

The present invention discloses the application of a conductive hydrogel combined with electrical stimulation in the treatment of diabetic foot ulcers caused by neuropathy, belonging to the field of biomedicine. The conductive hydrogel is obtained by mixing chitosan, polyvinyl alcohol, MXene and gelatin. The chitosan is chitosan modified with catechol groups, the MXene is MXene modified with polyphenols and Mg ions, and the gelatin is gelatin modified with phenylboronic acid. The condition of the electrical stimulation is 100 mV cm-1. The diabetic foot ulcers include diabetic foot ulcers caused by neuropathy. Through experimental verification, the conductive hydrogel prepared by the present invention combined with electrical stimulation can promote cell migration, accelerate the wound healing of diabetic foot ulcers and achieve functional repair. The present invention provides a new idea for the clinical treatment of diabetic foot ulcers caused by neuropathy.

The invention belongs to the field of medicine health. Specifically, the invention provides preparation and application of a lysate of platelets differentiated in vitro. Specifically, the invention provides application of the lysate in effectively promoting migration of cells to a skin injury, reducing inflammation, limiting matrix degradation and promoting collagen synthesis to support wound healing.

The invention belongs to the technical field of optimized coding genes, and discloses a recombinant human V-type collagen as well as a preparation method and application thereof, the amino acid sequence of the recombinant human V-type collagen comprises a basic repetitive unit, and the basic repetitive unit is VQGPPGPAGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHR. The collagen provided by the invention has no cytotoxicity, has good effects of promoting cell proliferation and cell migration, is high in safety, and has the potential of being applied to the fields of medicines, medical instruments, biological materials and tissue engineering.