Adenovirus carrier vaccine carrying HIV gene

A carrier vaccine and adenovirus technology, applied in gene therapy, antiviral agents, genetic engineering, etc., can solve the problem of vaccine immunogenicity decline and other issues

Inactive Publication Date: 2008-07-16
GUANGZHOU INST OF BIOMEDICINE & HEALTH CHINESE ACAD OF SCI
View PDF1 Cites 8 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, it is also believed that the combination of multiple antigen genes may cause antigenic competition and lead to a decrease in the immunogenicity of the vaccine

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Adenovirus carrier vaccine carrying HIV gene
  • Adenovirus carrier vaccine carrying HIV gene
  • Adenovirus carrier vaccine carrying HIV gene

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0052] HIV1 gag vaccine sequence:

[0053] 1. The 08BC gag consensus sequence is from lanl, and the sequence is

[0054] MGARASILRGGKLDKWEKIRLRPGGKKHYMLKHLVWASRELERFALNPGLLETSEGCKQIIKQLQPALQTGTEELRSLFNTVATLYCVHAEIEVRDTKEALDKIEEEQNKIQQKTQQAKEADEKVSQNYPIVQNLQGQMVHQPLSPRTLNAWVKVVEEKAFSPEVIPMFTALSEGATPQDLNTMLNTVGGHQAAMQMLKDTINEEAAEWDRLHPVHAGPVAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIKQGPKEPFRDYVDRFFKTLRAEQATQDVKNWMTDTLLVQNANPDCKTILRALGPGASLEEMMTACQGVGGPSHKARVLAEAMSQTNNTILMQRSNFKGSKRIVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPAESFRFEETTPAPKQEPKDREPLTSLRSLFGSDPLSQ

[0055] 2. The following is the complete gag sequence of HIV1 (CRF08BC) containing optimized codons.

[0056]atgggcgccagggcctccatcctgaggggcggcaagctggacaagtgggagaagatcaggctgaggcctggcggcaagaagcactacatgctgaagcatctggtctgggcctccagggagctggagaggtttgccctgaaccctggcctgctggagacctctgagggctgcaagcagatcatcaagcagctgcagcctgccctgcagacaggcacagaggagctgaggtccctgttcaacacagtggccaccctgtactgtgtgcatg...

Embodiment 2

[0058] HIV1 pol vaccine sequence:

[0059] 1. The 08BC pol consensus sequence is from lanl, and the sequence is

[0060] FFREILAFPQGEAREFPPEQTRANSPTSRELQVRGDNPSSEAGTERQGTLNFPQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYEQIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPDNPYNTPIFAIRKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAELELAENREILKEPVHGAYYDPSKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTAHTNDVKQLTEAVQKIAMESIVIWGKIPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTPPLVKLWYQLEKDPIAGVETFYVDGAANRETKIGKAGYVTDRGRKKIVSLTDTTNQKTELQAIYIALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHKGIGGNEQVDKLVSNGIRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDQCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSNFTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKL...

Embodiment 3

[0076] HIV1 nef vaccine sequence:

[0077] 1. The consensus sequence of 08BC nef comes from lanl, and the sequence is

[0078] MGGKWSKSSIVGWPAIRERIRRTEPAADGVGAVSRDLEKHGAITSSNTADTNADCAWLETQEEEEVGFPVRPQVPLRPMTFKGALDLSFFLKEKGGLEGLIYSKKRQEILDLWVYHTQGYFPDWHNYTPGPGVRFPLTFGWCFKLVPVDPREVEEANEGEDNCLLHPVCQHGMEDEHREVLKWKFDHPSQLAKHRAREL

[0079] 2. The transformation steps are: Nef needs myristylation sites (the 2nd amino acid glycine G2, the 164th and 165th leucine Leu-164-Leu-165) to exert most of the functions, these three sites Both mutated to alanine, Nef is functionally inactive.

[0080] 3. The following is the complete nef sequence of HIV1 (CRF08BC) containing optimized codons.

[0081] Atggctggcaagtggtccaagtcctccattgtgggctggcctgccatcagggagaggatcaggaggacagagcctgctgctgatggcgtgggcgctgtctccagggacctggagaagcatggcgccatcacctcctccaacacagctgacaccaatgctgactgtgcctggctggagacccaggaggaggaggaggtgggcttccctgtgaggccccaggtgcccctgaggcccatgaccttcaagggcgccctggacctgtccttcttcctgaaggagaagggcggcctggagggc...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention describes an adenovirus vector which carries a HIV structure gene of codon optimization and / or a HIV regulatory and auxiliary gene as well as a heterogenous promoter and a transcription terminator. When a first-booster immunization proposal is adopted by a single or combined plasmid vector vaccine, the vector-viral vaccine can be used for preventing HIV infection.

Description

1. Technical field [0001] The present invention relates to a codon-optimized polynucleotide or a fragment or derivative thereof. The present invention also relates to the polypeptide or protein encoded by the optimized nucleic acid sequence or its fragment or derivative. The present invention further relates to adenoviral vectors carrying the optimized polynucleotide and other viral vectors. The polynucleotide, polypeptide or protein and the viral vector carrying the polynucleotide can be used as a vaccine, preferably for the prevention of HIV infection. 2. Background technology [0002] Human immunodeficiency virus (Human Immunodeficiency Virus, HIV-1) is the pathogen of acquired immunodeficiency syndrome (Acquired human Immune Deficiency Syndrome, AIDS). [0003] AIDS (AIDS) has only been discovered for more than 20 years, and the number of people infected with AIDS in the world has reached 69 million, of which 32 million have died. At present, the AIDS epidemic in my c...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): A61K48/00C12N15/861C12N15/49A61P31/18
Inventor陈凌马鑫
OwnerGUANGZHOU INST OF BIOMEDICINE & HEALTH CHINESE ACAD OF SCI