Epitope polypeptide applicable to mycobacterium tuberculosis infection detection and application thereof
A technology of Mycobacterium tuberculosis and a polypeptide library is applied to epitope polypeptides that can be used for the detection of Mycobacterium tuberculosis infection and its application field, which can solve the problems of inapplicability for widespread promotion, high cost, and difficulty in evading patent protection.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0023] Embodiment 1 can be used for the antigen that Mycobacterium tuberculosis detects
[0024] Mycobacterium tuberculosis specific antigen Rv3615c, its amino acid composition is shown in SEQ ID NO.10.
[0025] SEQ ID NO.10:
[0026] MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLT
[0027] AHNALGS SLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT
Embodiment 2
[0028] Example 2 Polypeptides that can be used for Mycobacterium tuberculosis detection
[0029] The amino acid sequence of the polypeptide is a polypeptide composed of 8-11 consecutive amino acids in the antigen Rv3615c, as shown in the following table, preferably such as SEQ-ID-NO.1, SEQ-ID-NO.2, SEQ-ID-NO .5, shown in SEQ-ID-NO.6, SEQ-ID-NO.7.
[0030] Table 1. Epitope peptide information:
[0031]
Embodiment 3
[0032] Embodiment 3 antigen is applied to the development of detection kit
[0033] The antigen protected by this patent can be used for the diagnosis of Mycobacterium tuberculosis infection, forming a kit for clinical or laboratory diagnosis.
[0034] The test kit contains:
[0035] 1. A mixed polypeptide peptide library composed of one or several polypeptides in Example 2;
[0036] 2. Phytohemagglutinin (PHA) solution positive control stimulus;
[0037] 3. ELISPOT96-well PVDF membrane plate;
[0038] 4. Human γ-interferon monoclonal antibody (primary antibody), biotin-labeled human γ-interferon monoclonal antibody (secondary antibody), horseradish peroxidase-labeled streptavidin and horseradish peroxidation Substrates for enzyme reactions;
[0039] 5. Other reagents and consumables required for ELISPOT detection.
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com