Polypeptide inhibiting porcine PD-1/PD-L1 pathway and application thereof

Abstract

The invention discloses a polypeptide based on inhibiting porcine PD-1 / PD-L1 composite binding site. The immunological effect of the polypeptide after the polypeptide inhibits the porcine PD-1 / PD-L1 pathway is subjected to primary study, and basis is laid for acquiring polypeptide medicines or vaccine adjuvant for improving the immunological effect. The polypeptide is CTRRNDSGTYFCGAIYLPPKTQINESHQAKLT, and has a molecular weight of 4012.42Da.

Description

technical field [0001] The invention relates to animal molecular immunology, in particular to a polypeptide for blocking porcine PD-1 / PD-L1 pathway and its application. Background technique [0002] There are two signaling pathways in the immune system, activation and inhibitory regulation, and immune activation and inhibitory regulation coordinate with each other to maintain the dynamic balance of the immune system. TCR or BCR regulates T cell or B cell activation together with MHC molecule-antigen peptide and costimulatory signaling pathway B7 / CD28; in addition, there are a series of immunosuppressive surface molecules on the surface of T cells, such as PD-1, CTLA-4, Tim-3, ICOS, LFA1, SLAM, LAG-3, etc., bind to their corresponding ligands to activate immune negative regulatory pathways, leading to T cell failure. Among them, the PD-1 / PD-Ls pathway is the hotspot of current research. Studies have shown that in the course of various acute or chronic viral diseases, the exp...

AI Technical Summary

Problems solved by technology

TCR or BCR regulates T cell or B cell activation together with MHC molecule-antigen peptide and costimulatory signaling pathway B7 / CD28; in addition, there are a series of immunosuppressive surface molecules on the surface of T cells, such as PD-1, CTLA-4, Tim-3, ICOS, LFA1, SLAM, LAG-3, etc., bind to their corresponding ligands to activate immune negative regulatory pathways, leading to T cell failure

Among them, the PD-1 / PD-Ls pathway is the hotspot of current research. Studies have shown that in the course of various acute or chronic viral diseases, the expression of PD-1 and its ligands PD-L1 and PD-L2 increases, and PD-1 After binding with its ligand, it activates the downstream pathway of PD-1, inhibits the functions of T cell antiviral cytokine secretion, proliferation and CTL, and leads to immune suppression of the body

Images