Check patentability & draft patents in minutes with Patsnap Eureka AI!

Polypeptide inhibiting porcine PD-1/PD-L1 pathway and application thereof

A PD-L1, PD-1 technology, applied in medical preparations containing active ingredients, specific peptides, peptide/protein components, etc., can solve problems such as increased expression and T cell failure

Inactive Publication Date: 2015-07-08
XINXIANG UNIV
View PDF2 Cites 22 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

TCR or BCR regulates T cell or B cell activation together with MHC molecule-antigen peptide and costimulatory signaling pathway B7 / CD28; in addition, there are a series of immunosuppressive surface molecules on the surface of T cells, such as PD-1, CTLA-4, Tim-3, ICOS, LFA1, SLAM, LAG-3, etc., bind to their corresponding ligands to activate immune negative regulatory pathways, leading to T cell failure
Among them, the PD-1 / PD-Ls pathway is the hotspot of current research. Studies have shown that in the course of various acute or chronic viral diseases, the expression of PD-1 and its ligands PD-L1 and PD-L2 increases, and PD-1 After binding with its ligand, it activates the downstream pathway of PD-1, inhibits the functions of T cell antiviral cytokine secretion, proliferation and CTL, and leads to immune suppression of the body

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polypeptide inhibiting porcine PD-1/PD-L1 pathway and application thereof
  • Polypeptide inhibiting porcine PD-1/PD-L1 pathway and application thereof
  • Polypeptide inhibiting porcine PD-1/PD-L1 pathway and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0022] The present invention will be described in detail below in conjunction with the embodiments.

[0023] Peptide-labeled FITC

[0024] Use the FITC Antibody Labeling Kit to label FITC on the polypeptide. The FITC Antibody Labeling Kit can connect FITC to amino acid residues such as sulfhydryl, imidazole, carbonyl, and tyrosyl. The steps are as follows:

[0025] (1) Peptide preparation, add 40 μL of 0.67 mol / L sodium borate solution to 0.5 mL of 2 mg / mL peptide solution, and adjust the peptide concentration to 1 mg / mL;

[0026] (2) Add 0.5mL polypeptide into a tube containing about 30μL FITC reagent, mix well to fully dissolve the reagent, and incubate at room temperature in the dark for 60min;

[0027] (3) Add 400 μL of purified resin to the reaction tube, put the reaction tube into a micro collection tube, centrifuge at room temperature for 30-45 sec at 1000 r / min, and discard the collection tube;

[0028] (4) Put the reaction tube into a new collection tube, add 250-27...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a polypeptide based on inhibiting porcine PD-1 / PD-L1 composite binding site. The immunological effect of the polypeptide after the polypeptide inhibits the porcine PD-1 / PD-L1 pathway is subjected to primary study, and basis is laid for acquiring polypeptide medicines or vaccine adjuvant for improving the immunological effect. The polypeptide is CTRRNDSGTYFCGAIYLPPKTQINESHQAKLT, and has a molecular weight of 4012.42Da.

Description

technical field [0001] The invention relates to animal molecular immunology, in particular to a polypeptide for blocking porcine PD-1 / PD-L1 pathway and its application. Background technique [0002] There are two signaling pathways in the immune system, activation and inhibitory regulation, and immune activation and inhibitory regulation coordinate with each other to maintain the dynamic balance of the immune system. TCR or BCR regulates T cell or B cell activation together with MHC molecule-antigen peptide and costimulatory signaling pathway B7 / CD28; in addition, there are a series of immunosuppressive surface molecules on the surface of T cells, such as PD-1, CTLA-4, Tim-3, ICOS, LFA1, SLAM, LAG-3, etc., bind to their corresponding ligands to activate immune negative regulatory pathways, leading to T cell failure. Among them, the PD-1 / PD-Ls pathway is the hotspot of current research. Studies have shown that in the course of various acute or chronic viral diseases, the exp...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/705A61K38/17A61K39/39A61P37/04
Inventor 王选年岳锋朱艳平李鹏孙国鹏张艳芳
Owner XINXIANG UNIV
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More