Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

601results about How to "Good immune effect" patented technology

Subunit vaccine for novel coronavirus and application of subunit vaccine

The invention discloses a fusion protein of a novel coronavirus envelope protein and an application of the fusion protein. The fusion protein (SARS2-RBD-Fc) is obtained by fusing an RBD structural domain of a novel coronavirus envelope protein S with an antibody Fc fragment; and as a subunit vaccine, the fusion protein can induce an organism to generate an efficient neutralizing antibody through nasal drip immunization and intramuscular injection. It indicates that the SARS2-RBD-Fc can be used as a candidate vaccine for preventing and treating new coronavirus infection.
Owner:WUHAN INST OF VIROLOGY CHINESE ACADEMY OF SCI

Biological Chinese herbal feed additive for broiler chicken and preparation method thereof

The invention discloses a biological Chinese herbal feed additive for broiler chicken. The additive is prepared by microbial fermentation of active pharmaceutical ingredients namely Chinese herbal medicines, wherein the active pharmaceutical ingredients of the Chinese herbal medicines comprise the following components in parts by weight: 1-8 of leguminosae, 2-5 of dryopteris setosa, 0.5-4 of radix isatidis, 0.5-5 of radix polygoni multiflori, 1-6 of hawthorn, 1-4 of fructus ligustri Lucidi, 0.5-5 of folium artemisiae argyi, 1-5 of fructus hordei germinatus and 1-4 of radix glycyrrhizae. By utilizing the biological Chinese herbal feed additive, the average weight of the broiler chicken is obviously increased, and the feed conversion ratio is reduced; the immunoglobulin G (IgG) level and newcastle disease (ND) antibody level of broiler chicken blood serum are obviously improved; and the activities of glutathione peroxidase (GSH-PX) and superoxide dismutase of the broiler chicken blood serum are obviously improved, and the content of malondiadehyde (MDA) of leg muscle is greatly reduced. Experiments show that by utilizing the biological Chinese herbal feed additive, the production performance and chicken quality of the broiler chicken can be improved, and the antioxidant capability and immunity of an organism are increased.
Owner:HEBEI AGRICULTURAL UNIV.

Multivalent pneumococcal capsular polysaccharide composition as well as preparation method and application thereof

The invention provides a multivalent pneumococcal capsular polysaccharide composition as well as a preparation method and application thereof. The multivalent pneumococcal capsular polysaccharide composition contains a serotype 6A and at least one extra serotype selected from the group consisting of 1, 2, 3, 4, 5, 6B, 7F, 8, 9N, 10A, 11A, 12F, 14, 15B, 17F, 18C, 19A, 19F, 20, 22F, 23F and 33F. The multivalent pneumococcal capsular polysaccharide composition provided by the invention can be used for inducing an organism to generate humoral immunity, can generate a relatively good protecting effect for infectious diseases caused by the 24 common serotype pneumococcuses and is wide in immunity coverage rate and better in effect as comparison with various existing pneumococcal polysaccharide vaccines and conjugate vaccines sold on the market.
Owner:SINOVAC RES & DEV

Targeted genetic engineering vaccine for African swine fever immune system

The invention belongs to the technical field of vaccines, and particularly relates to a targeted genetic engineering vaccine for an African swine fever immune system. The main raw material of the African swine fever immune system targeted genetic engineering vaccine is African swine fever fusion protein. The African swine fever fusion protein comprises a fragment selected from p72 protein, a fragment selected from p54 protein and a fragment selected from p30 protein. Wherein the fragment selected from the p72 protein at least comprises a sequence as shown in SEQ ID NO.1, the fragment selectedfrom the p54 protein at least comprises a sequence as shown in SEQ ID NO.2, and the fragment selected from the p30 protein at least comprises a sequence as shown in SEQ ID NO.3. The African swine fever fusion protein has the advantages of good immune effect and the like.
Owner:河南省生物工程技术研究中心 +1

African swine fever B and T cell tandem epitope fusion vaccine

The invention, which belongs to the technical field of vaccines, particularly relates to an African swine fever B and T cell tandem epitope fusion vaccine. The main component of the African swine fever B and T cell tandem epitope fusion vaccine is African swine fever tandem epitope fusion protein. The African swine fever tandem epitope fusion protein comprises a B cell neutralizing epitope peptidefragment and a T cell epitope; and the B cell neutralizing epitope peptide comprises the following fragments: at least one neutralizing epitope peptide of each of p72, p54, p30 proteins. When the African swine fever tandem epitope fusion protein is used as a vaccine, the immune effect is good; and the antibody level significantly higher than that of a control group can be detected after one immunization. Since the non-neutralizing epitope is reduced as much as possible in the fusion protein, the risk of accelerating virus infection (ADE effect and antibody dependence enhancement effect) by anon-neutralizing antibody after immunization can be avoided.
Owner:河南省生物工程技术研究中心 +1

Nucleic acid molecule for enhancing antitumor activity of T cells

The invention relates to a new chimeric antigen receptor (CAR) molecule containing an intracellular segment of DAP 10 protein, nucleic acid for encoding the CAR molecule, cells for expressing the CARmolecule, and use of the CAR molecule in preparation of medicines for treating tumors. The CAR molecule provided by the invention is realized by introducing the intracellular segment of the DAP 10 protein into the traditional second generation of CAR molecule; a downstream signaling pathway of the DAP10 of the T cells is activated after binding of the CAR molecule and a target antigen, so that thekilling effect of the corresponding CAR T cells on solid tumor in vivo and in vitro is improved, and the proliferation and survival abilities of the CAR T cells are enhanced.
Owner:SHENZHEN IN VIVO BIOMEDICINE TECH LTD

Beta-coronavirus antigen as well as preparation method and application thereof

The embodiment of the invention relates to a beta-coronavirus antigen as well as a preparation method and application thereof. Wherein the amino acid sequence of the beta-coronavirus antigen comprisesan amino acid sequence arranged according to a (A-B)-(A-B) style or an amino acid sequence arranged according to a (A-B)-C-(A-B) style or an amino acid sequence arranged according to a (A-B)-(A-B ')style or an amino acid sequence arranged according to a (A-B)-C-(A-B') style, and the beta-coronavirus antigen has a single-chain dimer structure. The single-chain dimer expressed by the embodiment ofthe invention is stable in content and has good immunogenicity as a beta-coronavirus antigen, and a vaccine prepared by using the single-chain dimer as a beta-coronavirus antigen can stimulate mice to generate a neutralizing antibody with very high titer.
Owner:INST OF MICROBIOLOGY - CHINESE ACAD OF SCI

Polypeptide inhibiting porcine PD-1/PD-L1 pathway and application thereof

The invention discloses a polypeptide based on inhibiting porcine PD-1 / PD-L1 composite binding site. The immunological effect of the polypeptide after the polypeptide inhibits the porcine PD-1 / PD-L1 pathway is subjected to primary study, and basis is laid for acquiring polypeptide medicines or vaccine adjuvant for improving the immunological effect. The polypeptide is CTRRNDSGTYFCGAIYLPPKTQINESHQAKLT, and has a molecular weight of 4012.42Da.
Owner:XINXIANG UNIV

Vaccine for hand-foot-and-mouth disease viruses

The invention relates to preparation of a vaccine for hand-foot-and-mouth disease viruses and an application method thereof, belonging to a novel vaccine for preventing infectious diseases. The vaccine of the invention mainly comprises the components of high-purified inactivated human enteropathogenic virus 71 (EV 71) and an aluminum adjuvant. The vaccine, which is prepared according to the method of the invention, has excellent immunogenicity, and after immunity, organisms can selectively generate a high titer serum neutralization antibody, thereby preventing infectious diseases caused by the human EV 71.
Owner:BEIJING LUZHU BIOTECH +1

Mycoplasma hyopneumoniae and Mycoplasma hyorhinosus dual inactivated vaccine and preparation method thereof

The invention provides a combined inactivated vaccine against mycoplasma hyopneumoniae (MHP) and mycoplasma hyorhinis. The combined inactivated vaccine contains the MHP and the mycoplasma hyorhinis with preferred content as well as a Carbomer adjuvant with concentration of 10% (V / V). The invention further provides a preparation method of the combined inactivated vaccine against the MHP and the mycoplasma hyorhinis. The preparation method comprises the following steps: preparing production strains; preparing bacterium solution for producing seedlings; and inactivating, concentrating and blending to obtain the vaccine. The combined inactivated vaccine has the advantages of strong specificity and good immunity, thus solving the problem of specific infection caused by the MHP in the current domestic breeding farm and obtaining the mycoplasma hyorhinis vaccine under a blank state at home and abroad at present. The combined inactivated vaccine has the beneficial effects that the step of vaccine inoculation is simplified, trouble caused by a plurality of inoculation and easily produced side effects are avoided, and vaccine cost is saved, thus being especially applicable to preventing andtreating mixed infection diseases in the breeding farms at home and abroad and the like; and compared with the existing single vaccine, application range is widened and immune effect is enhanced.
Owner:PU LIKE BIO ENG

Special fermented Chinese herbal medicine feed additive for laying hen and preparation method of special fermented Chinese herbal medicine feed additive

The invention discloses a special fermented Chinese herbal medicine feed additive for a laying hen. The special fermented Chinese herbal medicine feed additive is prepared by common fermentation of the following raw materials: 50-60 parts of Chinese herbal medicine mixed powder, 15-25 parts of bran, 12-18 parts of corn flour and 8-12 parts of microbial strain, wherein the Chinese herbal medicine mixed powder is prepared from glossy privet fruit powder, licorice powder, pine needle meal and alfalfa meal; the microbial strain is prepared from lactic acid bacteria, bacillus subtilis and bacillus licheniformis. The preparation method comprises the following steps: 1 respectively drying the taken glossy privet fruit, licorice, pine needle and alfalfa, crushing, screening and mixing evenly to prepare the Chinese herbal medicine mixed powder; and 2 adding the bran, the corn meal and the microbial strain to the Chinese herbal medicine mixed powder, adding purified water, mixing evenly, fermenting to obtain fermented materials, drying the fermented materials, crushing and screening to finish preparation. The additive disclosed by the invention is capable of effectively improving the organism immunity of the laying hen, so that the egg-laying property of the laying hen is improved; and the quality of the laid eggs is improved.
Owner:河南岐伯实业有限公司

Ready-to-use adjuvant of livestock vaccines, preparation and applications thereof

The invention provides a ready-to-use adjuvant of livestock vaccines, preparation and applications thereof, belonging to the field of the adjuvant of livestock vaccines. The ready-to-use adjuvant is prepared from the following substances: 5-30 percent of oil, 0.1-10 percent of hydrophilic surfactant, 0.1-10 percent of oleophilic surfactant, 0.1-10 percent of polymeric micelle substance and 40-90 percent of water. The invention also provides a preparation method of the ready-to-use adjuvant, and the method comprises the following steps: respectively weighing the substances, mixing and then emulsifying, and degerming to obtain the ready-to-use adjuvant of the livestock vaccines. The invention also provides an oil-in-water type vaccine with the ready-to-use adjuvant. The ready-to-use adjuvant is an oil-in-water type adjuvant and has the advantages of simple ingredients, stable dosage form, convenience in use and easiness in injection. The preparation method of the ready-to-use adjuvant has a simple process and is low in cost, and the obtained dosage form is stable. The oil-in-water type vaccine has the advantages of long stable period, easiness in storage, good immune effect, protection period prolonging, easiness in injection and small side reaction.
Owner:JIANGSU ACADEMY OF AGRICULTURAL SCIENCES

Controlled degradable surgical suture thread and fabricating method thereof

The invention discloses a controlled degradable surgical suture thread and a fabricating method thereof. The innermost part is chitosan fiber core, the middle part is collagen layer, and the outermost part is ethyloic-chitosan layer. From innermost to outermost, the thickness ratio of each layer is 2:X:(3-X), wherein X is larger than 1 and smaller than 3. The value of X is related to degradation velocity of the surgical suture thread: the larger the value, the faster the degradation velocity of the surgical suture thread, and the shorter the healing period of wound suitable to be sutured; andthe smaller the value, the slower the degradation velocity of the surgical suture thread, and the longer the healing period of wound suitable to be sutured. The fabricating method of the surgical suture thread comprises: (1) preparing chitosan fiber core and collagen; (2) covering a layer of collagen outside the chitosan fiber; (3) covering a layer of ethyloic-chitosan outside the collagen cover of the chitosan fiber; (4) processing and polishing the suture thread prepared in (3) by an automatic coreless grinder, connecting with suture needles of different models to prepare into a finish product of surgical suture thread. The technical scheme of the invention has plentiful advantages: controllable degradation velocity, high tension strength, improved biocompatibility and anti-infectious property, quick wound healing, no obvious scars, good biocompatibility, etc.
Owner:GENERAL HOSPITAL OF THE SECOND ARTILLERY OF CHINESE PLA

Gene segments for coding alpha, beta or gamma interferons of pigs and application thereof

ActiveCN101818154AGood immune regulationBroad prospects for promotion and applicationMicroorganism based processesFermentationInterferonYeast
The invention relates to gene segments for coding alpha, beta or gamma interferons of pigs and an application thereof. According to the preference of codons of a Pichia stipitis expression system, high-expression codons are selected to renewedly design and synthesize new mature peptide nucleotide sequences of the alpha, beta and gamma interferon of the pigs, and recombinant yeast expression plasmids of pPICZalphaC-IFN-alpha, pPICZalphaC-IFN-beta and pPICZaplhaC-IFN-gamma are successfully constructed, which not only correctly expresses the alpha, beta and gamma interferons of the pigs in Pichia stipitis, but also enables the alpha, beta and gamma interferons of the pigs to be easier to express in the Pichia stipitis with higher expression level, and lays a foundation for the large-scale production and fermentation of the gene engineering.
Owner:SOUTH CHINA AGRI UNIV +1

Pig feed additive

The invention discloses a pig feed additive which belongs to the field of feed and relates to a feed additive. The pig feed additive comprises the following components in parts by weight: 10-25 parts of yeast extract, 10-18 parts of high-temperature resistance lactic acid bacteria, 5-10 parts of soybean peptide, 8-18 parts of ganoderma fruiting body, 5-15 parts of bran, 10-22 parts of cordyceps mycelia, 1-3 parts of fructose-oligosaccharide, 1-4 parts of raffinose, 1-3 parts of cellulase, 1-2 parts of protease, 1-3 parts of mixed amino acids and 0.5-2 parts of amino acid chelated copper. After being compounded, the pig feed additive has the advantages of having very good anti-diarrhea effect, effectively enhancing the immunity of piglets, reducing the application amount of antibiotic products and improving the growth quality of the piglets; and through application of the pig feed additive, the phenomena that the piglets have long hair in a nursing stage, and the growth and development of the pigments are hindered after the nursing stage are avoided.
Owner:南通华多种猪繁育有限公司

Pig pseudorabies virus subunit vaccine and preparation method and application thereof

The invention discloses a pig pseudorabies virus subunit vaccine and a preparation method and an application thereof, which belong to the field of a biological product used for animal. The method comprises the following steps: 1) respectively cloning and amplifying a gB protein fragment gene and a gC protein fragment gene; 2) performing artificial synthesis of an escherichia coli enterotoxin gene STLT; 3) constructing plasmid for expressing fusion protein gB-STLT-gC; and 4) expressing to obtain a gB-STLT-gC recombinant protein, purifying the recombinant protein, adding an adjuvant, and performing emulsification to obtain the pig pseudorabies virus subunit vaccine. The preparation method is simple, the antigen protein of pig pseudorabies virus is massively prepared, the method has the advantages of short time consuming, high expression level, and greatly reduced production cost, and is in favor of large scale production, the obtained subunit vaccine has the advantages of good immunization effect and small immunization dosage, and can effectively prevent the pig pseudorabies virus-related disease and disease related to infection due to pig pseudorabies virus.
Owner:扬州优邦生物药品有限公司

Fruit juice milky tea with abundant selenium

The invention relates to a selenium-enriched milky tea with fruit juice which comprises the following raw materials (by weight ratio), milk 150-200 parts, fruit juice 150-200 parts, oolong tea 8-10 parts, American ginseng powder 1-2 parts, selenium-enriched mushroom pileus powder 8-10 parts, and refined granulated sugar 20-30 parts. The milky tea has the function of enhancing body energy and resisting fatigue.
Owner:宿彦军

Method for improving proliferation capability of mycoplasma gallisepticum in vaccine production

The invention relates to a method for improving proliferation capability of mycoplasma gallisepticum in vaccine production, vaccines are prepared through the process steps of preparing seeds, preparing a culture medium of the mycoplasma gallisepticum, preparing vaccine-making bacterial liquid and preparing the inactivated vaccines, after improvement, the content of PPLO (pleuropneumonia-like organism) broth, porcine serum and glucose is increased, MEM (minimum essential medium) ingredients are removed, and the mixture ratio of the ingredients in the culture medium are more scientific and the nutritional value is higher after adjustment. The bacterial liquid concentration of a semi-finished product prepared by the method is as high as 1.0*1013CCU / ml-1.0*1014CCU / ml, and the bacterial liquiddoes not need to be concentrated and can be directly or indirectly used for preparing the inactivated vaccines after dilution, thereby not only simplifying the production process, but also reducing the production cost.
Owner:RINGPU (BAODING) BIOLOGICAL PHARMACEUTICAL CO LTD

Duck virus hepatitis strains and inactivated vaccine

The invention discloses methods for preparing a duck virus hepatitis strain and an inactivated vaccine. The strain is obtained with the method comprising the following steps of: collecting duck hepatitis material with obvious pathological changes in a duck farm where duck virus hepatitis prevails, washing with bi-anti-sterilization PBS, diluting and grinding, freeze thawing twice and performing centrifugal separation; diluting virus separated by sterilization PBS, vaccinating chick embryo, selecting chick embryo with classic pathological changes that is dead 48-96h after vaccination, respectively gaining chick embryo liquid, transferring for 18-25 generations continuously to obtain a duck virus hepatitis virus chick embryo suitable strain. The strain can be in production, vaccinated in the chick embryo to gain chick embryo liquid, and is emulsified after vaccination to prepare the inactivated vaccine. The inactivated vaccine is high in safety, has good immune efficacy to young ducks, long immune time for breeding ducks and high level of antibody of breeding ducks, and the young ducks bred by the breeding ducks can resist duck virus hepatitis strains.
Owner:PU LIKE BIO ENG

Ecological health-care type special feed additive for carps

The invention relates to an ecological health-care type special feed additive for carps. The ecological health-care type special feed additive is composed of the following components in parts by weight: 10-15 parts of pine needle meal, 2-6 parts of albizia flower, 3-6 parts of poria cocos, 2-4 parts of white paeony roots, 3-5 parts of schizonepeta, 2-4 parts of honeysuckle stems, 3-6 parts of cordate houttuynia, 2-4 parts of semen cuscutae, 3-4 parts of cortex acanthopanacis, 3-5 parts of zeolite powder, 2-4 parts of carrots, 1-1.5 parts of probiotics powder, 0.2-0.5 part of chitosan and 0.2-0.4 part of allicin. The ecological health-care type special feed additive for the carps disclosed by the invention has the advantages that the dose is small, only 0.2-1% of the additive needs to be added into a compound feed and the adding cost is low; the economic benefits of culture of carps can be obviously improved and diseases in the cultivating process of the carps can be obviously lowered; the survival rate is improved by 10-12%; the feed conversion rate in the cultivating process of the carps can be effectively improved; and the growth of the carps is promoted and the quality of fish is improved.
Owner:武汉中科瑞华生态科技股份有限公司

Feed for weaned pigs and preparation method for feed

ActiveCN103300247AReduce the effects of weaning stressReduce lossesAnimal feeding stuffAnti virusDL-methionine
The invention discloses a feed for weaned pigs. The feed comprises the following components: weaned pig feed core material, smashed microwave corn powder, smashed microwave bean powder, fermented bean meal, wheat middling, steam fish meal, high-fat whey powder, calcium hydrogen phosphate, an anthony pig compound premix, a compound acidifying agent, a compound emulsifying agent, choline chloride, an antioxidant, a mold removal agent, edible salt, 98 percent of lysine hydrochloride, DL-methionine and mountain flour. The preparation method for the feed comprises the following steps of: performing microwave treatment on corns and beans, then smashing and screening the corns and the beans, and proportionally mixing the components. According to the feed, the problem of weaning of anthony pigs is solved by weakening the weaning stress of the anthony pigs, improving the anti-virus capability of the anthony pigs and improving the immunity of the anthony pigs; the daily weight gain of the anthony pigs can be effectively increased; the material-to-meat ratio can be reduced; the diarrhea rate is reduced by over 3 percent; the daily feed intake is increased by over 6 percent, so that the anthony pigs have high stress resistance and immunity.
Owner:LUOGANG BRANCH GUANGDONG WANGDA GRP +1

Method for foot-and-mouth disease vaccine concentration and purification

The invention provides an effective novel method for foot-and-mouth disease viral antigen concentration and purification. The method comprises the following steps of: 1) eliminating large particle matters in the antigen by using a continuous flow centrifuge; 2) processing the antigen liquid after the step 1) by using a hollow fiber ultra-filtration system; and 3) processing the circulation liquid after the step 2) by using PEG6000 (polyethylene glycol 6000). By utilizing the method for foot-and-mouth disease vaccine concentration and purification, provided by the invention, both the concentration and purification of the foot-and-mouth disease viral antigen can be carried out; and the manufactured foot-and-mouth disease vaccine has the advantages of good immune effect and less adverse reaction.
Owner:JINYUBAOLING BIO PHARM CO LTD

Prepn and usage of outer membrane protein subunit vaccine of seawater fish morbid vibrio

InactiveCN101020051AChemical properties determinedImmunospecific stabilityAntibacterial agentsPharmaceutical non-active ingredientsDiseaseBacteroides
The present invention is preparation and usage of outer membrane protein subunit morbid vibrio vaccine for seawater fish. The vaccine is prepared through extracting two or more of Vibrio alginolyticus, Vibrio Hrveyi, Vibrio vulnificus, Vibrio parahaemolyticus, etc, and adding immunostimulating complex. The vaccine preparing process includes culturing vibrio, extracting outer membrane protein and preparing vaccine. The vaccine containing partial pathogen and no infecting component has stable immunological specificity and no hidden danger of restoring toxici. The vaccine is used in preventing fishes' skin ulcer, eyeball turbidity and other vibrio caused diseases and may be used widely for immunizing seawater fish.
Owner:GUANGDONG OCEAN UNIVERSITY

Vaccine reagent kit for preventing carious tooth and method of use thereof

InactiveCN101411872AImproving immunogenicityComprehensive persistent immune responseBacterial antigen ingredientsDigestive systemAdjuvantA-DNA
The invention relates to a vaccine reagent kit for preventing decayed tooth, which comprises antigen and adjuvant, wherein the antigen is a dna recombinant plasmid of at least one surface proteantigen and at least one glucosyltransferase which co-express decayed tooth streptococcus mutans; and the adjuvant is flagellins of one or more than one germ. The vaccine reagent kit for preventing the decayed tooth has strong immunogenicity, can excite comprehensive and lasting immune response, and has strong specificity, even immune effect and simple and convenient operation. The invention also provides an application method for the vaccine reagent kit for preventing the decayed tooth, and the vaccine reagent kit has good immune effect and simple and convenient operation.
Owner:WUHAN INST OF VIROLOGY CHINESE ACADEMY OF SCI

Effective fodder for fattening geese

InactiveCN105076789ANutritional balanceReduce goose mortalityAnimal feeding stuffAnimal scienceGoose
The invention discloses effective fodder for fattening geese. The effective fodder is characterized in that the effective fodder comprises, by weight, 10-40 parts of maize, 22-35 parts of wheat, 15-25 parts of rice bran, 0.5-3 parts of lard oil, 5-10 parts of chrysanthemum meal, 8-15 parts of maize bran, 1-6 parts of fermentation biological proteins, 0.5-2 parts of feather meal, 1-4 parts of cottonseed meal, 8-13 parts of maize germ meal, 5-10 parts of sunflower cakes, 1-3 parts of silkworm powder, 1-2 parts of seaweed meal, 1-4 parts of pumpkin powder, 0.5-2 parts of mountain flour, 1-6 parts of Chinese herbal medicine additive, 0.05-0.5 part of natural pigment, 0.5-1 part of compound enzyme, 1-2 parts of phytase and 10-15 parts of effective phagostimulant. The effective fodder is green, healthy, balanced in nutrition, capable of reducing the fatality rate of geese effectively and low in cost.
Owner:ANHUI BAIXIN FEED CO LTD

Antigen covalently bound chitosan nanoparticle-based nasal immune carrier

The invention belongs to the technical field of medicines, and relates to an antigen covalently bound chitosan nanoparticle-based nasal immune carrier and a preparation method thereof. The carrier is composed of a nanoparticle and an antigen, the antigen is covalently bound to the surface of the nanoparticle, and the nanoparticle is prepared by adopting a raw material chitosan and its derivatives; and the antigen is selected from from infectious diseases or tumors related proteins or polypeptides. The carrier can significantly improve the neck lymph node targeting of people nasally dosed with the antigen proteins or polypeptides, enhances the mucosal and systemic immune response, has the advantages of simple preparation, stable process, high antigen utilization rate, difficult antigen shedding, benefiting of the improvement of the cervical lymph node transportation of the antigens, good nasal immune effect and no nasal mucosa toxicity, and is suitable for preventing respiratory infectious diseases.
Owner:FUDAN UNIV

Oil emulsion vaccine for broilers and preparation method thereof

The invention discloses an oil emulsion vaccine for broilers and a preparation method thereof. The oil emulsion vaccine comprises a water phase and an oil phase, wherein the water phase contains concentrated and inactivated ND (newcastle disease) and H9 AI (avian influenza) venom and Tween-80; the oil phase contains an oil adjuvant formed by white oil, Span-80 and aluminium stearate; the volume ratio of the water phase to the oil phase is (1:1.6) to (1:2); and the kinematic viscosity (40 DEG C) of the selected white oil is 4-8mm<2> / s. The oil emulsion vaccine has the characteristics of easiness in absorption, quick effect and high level of the generated antibodies, is suitable for growth of the broilers, can effectively increase the immune levels of the broilers, can effectively protect the broilers from being invaded by ND and H9 AI viruses and avoids ND and H9 AI in the immune phase.
Owner:TIANJIN RINGPU BIO TECH
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More