Unlock instant, AI-driven research and patent intelligence for your innovation.

New application of CTRP13 fat factor

A kind of adipokines, downstream technology, applied in the field of medicine

Pending Publication Date: 2021-10-29
XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV
View PDF6 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0009] In view of the above problems, the present invention provides some new uses of CTRP13 and new therapeutic drugs for some diseases, which mainly solves the existing CTRP13 and fills up the research gaps in some vascular diseases

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • New application of CTRP13 fat factor
  • New application of CTRP13 fat factor
  • New application of CTRP13 fat factor

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0071] After carotid balloon injury or sham operation injury in SD rats, CTRP13 (10 mg / kg·d) and vehicle (DMSO) were injected intraperitoneally, respectively. After 14 days, the mice were euthanized and a revascularization procedure was performed on the injured blood vessels. After fixed with 4% formaldehyde and embedded in paraffin, the blood vessels were sectioned. figure 1 Oil red-hematoxylin (HE) staining was used to detect the vascular morphology of rat carotid arteries after balloon injury in the sham operation + vehicle treatment group, balloon + vehicle treatment group, and balloon + CTRP13 treatment group. The result is as figure 1 shown. in figure 1 From left to right, the statistical charts of the average carotid artery thickness in the sham operation + vehicle treatment group, the balloon + vehicle treatment group, and the balloon + CTRP13 treatment group. Depend on figure 1 It can be seen that compared with the sham operation + vehicle treatment group, the ca...

Embodiment 2

[0073] After VSMC cells were treated with PDGF-BB (30ng / ml), they were stimulated with different concentrations of CTRP13 (100, 200, 300ng / ml) and carrier DMSO. figure 2 The EdU assay was used to detect the proliferation of VSMC cells for different concentrations of CTRP13. The first column is vehicle treatment group, the second column is PDGF-BB and vehicle treatment group, the third column is PDGF-BB and 100ng / ml CTRP13 treatment group, the fourth column is PDGF-BB and 200ng / ml CTRP13 treatment group, the fifth column is PDGF-BB and 300ng / ml CTRP13 treatment group. Depend on figure 2 It can be seen that after PDGF-BB treatment of VSMC cells, EdU-positive cells increased, and after further treatment with CTRP13, EdU-positive cells decreased, and with the increase of CTRP13 concentration, the amount of EdU-positive cells decreased. In conclusion, PDGF-BB treatment of VSMC cells can promote the proliferation of VSMC cells, while CTRP13 can inhibit the cell proliferation ind...

Embodiment 3

[0075] After VSMC cells were treated with PDGF-BB (30ng / ml), they were stimulated with different concentrations of CTRP13 (100, 200, 300ng / ml) and the carrier DMSO. After the cells were collected and the protein was extracted, the cyclins and tumor suppressors were detected by Western blot. protein expression, the results are as follows image 3 shown. Expression of cell cycle proteins (PCNA, CyclinD1) and tumor suppressor proteins (P27, P21) in VSMC cells under different treatments. Depend on image 3 It can be seen that after treatment with PDGF-BB, the expression of cyclins in VSMC cells increased and the expression of tumor suppressor proteins decreased; after stimulation with CTRP13, the expression of cyclins decreased and the expression of tumor suppressor proteins increased; while the expression of apoptosis-related proteins No significant changes.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention belongs to the field of medicines, and particularly discloses a novel application of a CTRP13 fat factor. The invention discloses application of CTRP13 in preparation of a PDGFR beta phosphorylation inhibitor and / or a PDGFR downstream signal pathway inhibitor. The PDGFR beta phosphorylation and / or PDGFR downstream signal pathway inhibitor includes the CTRP13. The invention further discloses application of the PDGFR beta phosphorylation and / or PDGFR downstream signal pathway inhibitor in preparation of a smooth muscle phenotype conversion inhibition medicament. The invention further discloses application of the CTRP13 in preparation of the smooth muscle phenotype conversion inhibition medicament. The CTRP13 provided by the invention has an inhibiting effect on PDGFR beta, and thus, the CTRP13 can inhibit smooth muscle phenotype conversion, thereby preventing and / or treating restenosis after the vascular injury; in addition, the CTRP13 does not have the cytotoxic effect of general cardiovascular drugs or other smooth muscle phenotype conversion inhibitors, and thus, the safety of the CTRP13 can be expected; and the CTRP13 can be widely applied as a medicine for treating related diseases involved in smooth muscles, such as vascular restenosis, tumors and the like.

Description

technical field [0001] The invention belongs to the field of medicine, and in particular relates to some new applications of CTRP13 adipokines. Background technique [0002] Human C1q tumor necrosis factor-related protein 13, the English name is CTRP13, and its alias is Complement C1qLike 3; C1q And Tumor Necrosis Factor-Related Protein 13; Complement Component1, Q Subcomponent-Like 3; Complement C1q-Like Protein 3; contains 255 amino acids , and its molecular weight is 26719Da. [0003] NCBI reference sequence number: NP_001010908.1, the amino acid sequence is as follows: [0004] MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD。 [0005] In recent years, members of the complement C1q / TNF-related proteins (CTRPs) family have attracted great attention in the research on...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A61K38/19A61K45/06A61P9/14A61P9/10A61P13/12A61P9/12A61P35/00
CPCA61K38/191A61K45/06A61P9/14A61P9/10A61P13/12A61P9/12A61P35/00A61K2300/00
Inventor 王成
Owner XIEHE HOSPITAL ATTACHED TO TONGJI MEDICAL COLLEGE HUAZHONG SCI & TECH UNIV