Compound and method for the prevention and/or the treatment of allergy

An allergy, compound technology, applied in the direction of fusion polypeptides, animal feed, cosmetic preparations, etc., can solve problems such as loss

Inactive Publication Date: 2001-09-19
LEUVEN RES & DEV VZW
View PDF6 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The peptides are modified in such a way that they retain their ability to bind to class II-MHC epitopes on specific B cells, but they lose their ability to activate the corresponding T cells (O'Hehir R.E. et al., International Immunology (International Immunology) 3, pp.819-826 (1991))

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Compound and method for the prevention and/or the treatment of allergy
  • Compound and method for the prevention and/or the treatment of allergy
  • Compound and method for the prevention and/or the treatment of allergy

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0102] A peptide of 31 amino acids consisting of 15 amino acids representative of the T-cell epitope of tetanus toxoid (amino acids 830-844 of the heavy chain) and 14 amino acids of the B-cell epitope comprising Der p II was obtained by synthesis, wherein The two epitopes are distinguished by a stretch of two glycine residues. The sequence is SEQ ID NO 1: QYIKANSKFIGITELGGHEIKKVLVPGCHGS.

[0103] Peptide Characterization

[0104] 1. IgE antibodies do not recognize this B cell epitope

[0105] IgE antibodies produced by individuals sensitive to the native protein do not recognize the peptide. This was demonstrated by immunoassays performed as follows. The peptides were immobilized on polystyrene microtiter plates and added in parallel to serum samples of atopic individuals sensitive to Der p II; binding of specific IgE antibodies was detected by addition of isotype-specific reagents.

[0106]Thus, a peptide (SEQ ID NO. 2) corresponding to the sequence HEIKKVLVPGCHGS of ami...

Embodiment 2

[0117] The compounds of the invention are prepared by recombinant cDNA techniques that generate polypeptides consisting of a series of repeating units comprising T and B cell epitope peptides. A polypeptide consisting of repeated T-cell epitopes derived from TT (amino acids 830-844 of the heavy chain) and six repeated B-cell epitopes derived from Der p II was prepared by DNA technology. A sequence of two amino acid residues is inserted between each epitope. The sequence is: D-(QYIKANSKFIGITELX)2-(CHGSEPCIIHRGKPFX)5-CHGSEPCIIHRGKPFSR,

[0118] where X is GG or SS.

[0119] Such polypeptides are obtained as follows. The nucleotide sequence corresponding to the TT epitope of QYIKANSKFIGITEL (SEQ ID NO. 13) and the nucleotide sequence of Der p II epitope 21-35 corresponding to CHGSEPCIIHRGKPF (SEQ ID NO. 14) were deduced. Theoretical assembly was performed from nucleotides corresponding to the sequence TT epitope-GG-TT epitope (T subunit) on the one hand and two copies of the D...

Embodiment 3

[0139] Nucleotide sequences encoding the compounds of the present invention can be used in direct genetic immunization. DNA-based vaccines can be administered by different routes (i.e., intramuscular, intradermal, subcutaneous, orally) using "naked" DNA, encapsulated DNA, or DNA in the form of micro- or nano-sized particles such as chitosan (K. Roy et al., Nature Medicine 1999; 5:387-391).

[0140] For direct intramuscular immunization, a nucleotide construct prepared according to Example 2 but comprising a DNA sequence encoding one T-cell epitope derived from TT and two B-cell epitopes derived from Der p II was used, Each epitope is separated by the sequence GGAGGT or GGCGGT encoding 2 glycine residues. The nucleotide sequence is flanked by a sequence comprising an EcoRI restriction enzyme site and a KOZAK sequence (i.e. GAATTCCCACCATGG (SEQ ID NO. 16)) at the 5' end and flanked by a stop codon and A NotI restriction site (ie TAGGCGGCCGC (SEQ ID NO. 17)), and inserted into ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention is related to a compound for the prevention and / or the treatment of allergy consisting of:at least one allergen antigenic determinant which is recognized by a B cell or an antibody secreted by a B cell of a non-atopic individual to said allergen, andat least one antigenic determinant of an antigen different from said allergen which triggers T cell activation.

Description

field of invention [0001] The present invention relates to new compounds and new methods for the prevention and / or treatment of allergies and / or diseases of allergic origin, in particular immediate hypersensitivity allergies. Background of the invention [0002] Immediate hypersensitivity is a form of allergic reaction that develops very rapidly, that is, occurs within seconds or minutes of patient exposure to the causative allergen. This immediate reaction can lead to a delayed secondary reaction that can lead to inflammatory changes in the target organ and manifest itself in chronic symptoms, such as asthma or atopic dermatitis. [0003] Immediate hypersensitivity reactions are mediated by antibodies that are predominantly but not exclusively of the IgE isotype. IgE antibodies bind to specific receptors on cells such as basophils, mast cells or Langerhans cells. Upon allergen exposure, surface-bound IgE signals into the cell, followed by cellular activation, in the case ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A23K1/16A23C9/13A23C21/08A23J3/04A23L1/305A23L2/52A61K8/00A61K8/64A61K8/72A61K38/00A61K39/35A61K45/00A61P11/02A61P11/04A61P11/06A61P17/00A61P37/08A61Q19/00C07K2/00C07K7/04C07K14/11C07K14/12C07K14/24C07K14/31C07K14/33C07K14/34C07K14/35C07K14/37C07K14/38C07K14/435C07K14/44C07K14/47C07K14/725C12N1/14C12N15/09C12N15/62
CPCC07K2319/00Y10S977/915A61K2039/51C07K14/38A61K38/00C07K14/4717C07K14/43531C07K14/31A61P11/02A61P11/04A61P11/06A61P17/00A61P37/08
InventorJ-M·圣-莱米M·杰克奎敏
OwnerLEUVEN RES & DEV VZW