A Protein Structure Prediction Method Based on Tree-structured Copy Exchange and Fragment Assembly

A protein structure and prediction method technology, applied in the field of three-dimensional structure prediction of protein structure, can solve the problems of large and complex protein conformation space, difficult protein folding problem, etc., and achieve the effect of reducing search cost and high efficiency

Active Publication Date: 2017-08-11
ZHEJIANG UNIV OF TECH
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, using computer computing power and optimization algorithms to predict the three-dimensional structure of proteins through protein sequence information, that is to say, the problem of protein folding is still a difficult problem.
[0006] The difficulty of protein structure prediction is mainly in two aspects, firstly, the energy model used for protein structure prediction is not accurate, and secondly, the conformational space of protein is extremely large and complex

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A Protein Structure Prediction Method Based on Tree-structured Copy Exchange and Fragment Assembly
  • A Protein Structure Prediction Method Based on Tree-structured Copy Exchange and Fragment Assembly
  • A Protein Structure Prediction Method Based on Tree-structured Copy Exchange and Fragment Assembly

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0059] The present invention will be further described below in conjunction with the accompanying drawings.

[0060] refer to figure 1 and figure 2 , a protein structure prediction method based on tree structure copy exchange and fragment assembly, the prediction method comprising the following steps:

[0061] A1. Protein conformation processing, using ID number 1ENH, its sequence sequence is RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKI, the process is as follows;

[0062] STEP1.1. Use the Rosetta software package pose_from_sequence function to construct a long protein chain according to the obtained protein amino acid sequence sequence;

[0063] STEP1.2, and use the Mover object SwitchResidueTypeSetMover constructed by Rosetta for the acquired protein long chain, and use its apply method to convert the all-atom conformation of the constructed protein long chain into the bone chain atomic conformation. The protein conformation is represented by pose, which is alwa...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

A protein structure prediction method based on tree structure copy exchange and fragment assembly, including the following steps: the protein conformation is based on the idea of ​​copy exchange, so as to enhance the search for the protein conformation space on the basis of retaining the information of multiple copies, and use the tree structure The advantages of the data structure, coupled with the use of energy hierarchy and shape information of protein intermediate conformations, and the use of specific weight functions to select a certain probability for the entire protein conformation space as a copy of the compilation, guide the protein conformation towards the energy The path stepping is low, and the diversity of protein conformation is preserved as much as possible, so as to finally predict the natural state of protein. The invention can greatly reduce the amount of calculation, shorten the calculation time, and at the same time ensure that the conformation with lower energy is searched.

Description

technical field [0001] The invention relates to the field of computer application, bioinformatics, algorithm optimization, optimization theory, molecular informatics, and in particular to a three-dimensional structure prediction method of protein structure. Background technique [0002] Bioinformatics reveals the biological mysteries endowed by large and complex biological data through the integrated use of biology, computer science and information technology. is a hotspot of current research. Bioinformatics research results have been widely used in sequence alignment, protein alignment, gene recognition analysis, molecular evolution, sequence contig assembly, genetic code, drug design, biological systems, protein structure prediction, etc. Among them, protein structure prediction is an important branch in the field of bioinformatics. [0003] Protein molecules play an important role in the cellular activities of organisms, and many activities of organisms are based on the...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityPatents(China)
IPC IPC(8): G06F19/16
Inventor张贵军秦传庆周晓根郝小虎梅珊陈先跑李章维
OwnerZHEJIANG UNIV OF TECH