A Protein Structure Prediction Method Based on Tree-structured Copy Exchange and Fragment Assembly
A protein structure and prediction method technology, applied in the field of three-dimensional structure prediction of protein structure, can solve the problems of large and complex protein conformation space, difficult protein folding problem, etc., and achieve the effect of reducing search cost and high efficiency
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0059] The present invention will be further described below in conjunction with the accompanying drawings.
[0060] refer to figure 1 and figure 2 , a protein structure prediction method based on tree structure copy exchange and fragment assembly, the prediction method comprising the following steps:
[0061] A1. Protein conformation processing, using ID number 1ENH, its sequence sequence is RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKI, the process is as follows;
[0062] STEP1.1. Use the Rosetta software package pose_from_sequence function to construct a long protein chain according to the obtained protein amino acid sequence sequence;
[0063] STEP1.2, and use the Mover object SwitchResidueTypeSetMover constructed by Rosetta for the acquired protein long chain, and use its apply method to convert the all-atom conformation of the constructed protein long chain into the bone chain atomic conformation. The protein conformation is represented by pose, which is alwa...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


