glp1/gip dual agonist or glp1/gip/glucagon triple agonist
A technology for hyperglycemia and body weight, applied in the direction of glucagon, hormone peptides, anti-toxins, etc., can solve the chemical instability of exendin-4 and other problems
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0353] definition
[0354] The amino acid sequences of the present invention contain the conventional one-letter or three-letter codes for naturally occurring amino acids, as well as the generally accepted three-letter codes for other amino acids, such as Aib (alpha-aminoisobutyric acid), Orn (ornithine ), Dab (2,4-diaminobutyric acid), Dap (2,3-diaminopropionic acid), Nle (norleucine), GABA (γ-aminobutyric acid) or Ahx (ε-aminocaproic acid )
[0355] In addition, the following codes were used for the amino acids shown in Table 4.
[0356] Table 4:
[0357]
[0358] The term "natural exendin-4" means a compound having the sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH 2 Native Exendin-4 of (SEQ ID NO: 1).
[0359] The present invention provides a peptide compound as defined above.
[0360] The peptidic compounds of the present invention comprise a linear backbone of aminocarboxylic acids linked by peptide bonds, ie, carboxamide bonds. Preferably, the aminocarboxy...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 



