35 results about "Aminocaproic acid" patented technology

The invention relates to the technical field of metal working fluids, in particular to a degradable environment-friendly vegetable oil-based semi-synthetic cutting fluid and a preparation method thereof. The cutting fluid comprises 20-30 parts of vegetable lubricating oil, 10-20 parts of an alkali storage agent, 2-5 parts of a corrosion inhibitor, 3-5 parts of a coupling agent, 5-8 parts of a surfactant and 6-11 parts of a composite anti-rust agent, the composite anti-rust agent comprises an anti-rust agent A and an anti-rust agent B, the anti-rust agent A comprises N-[3-(dimethylamino) propyl]-N, N-dimethylformamide, and the anti-rust agent B comprises N-[3-(dimethylamino) propyl]-N, N-dimethylformamide. The antirust agent A comprises at least one of N, N ', N'-trimethyl-1, 3-propanediamine, benzotriazole, sebacic acid and 2, 4, 6-tri (aminocaproic acid)-1, 3, 5-triazine, and the antirust agent B comprises at least one of an imidazoline compound and fatty acid sarcosine ester. The cutting fluid provided by the invention has excellent corrosion resistance, rust resistance, defoaming property, biodegradability and storage stability, and has a good application prospect.

The invention relates to the technical field of microorganisms, and particularly discloses a recombinant microorganism and application thereof in production of hexamethylenediamine. Compared with an original strain, the recombinant microorganism disclosed by the invention expresses a carboxylic acid reductase CAR variant, a CAR activating enzyme sfp and putrescine transaminase patA; the amino acid sequence of the carboxylic acid reductase CAR variant is as shown in SEQ ID NO. 28; preferably, adipic acid transporters DcaK and DcaP, acyl CoA transferases DcaI and DcaJ, an acylated succinate semialdehyde dehydrogenase sucD, and a 4-aminobutyric acid transaminase gabT are also expressed. By utilizing the recombinant microorganism, 6-aminocaproic acid / adipic acid can be efficiently converted into hexamethylenediamine, and a new method is provided for green biosynthesis of hexamethylenediamine.

The invention discloses a sulfonate grafted polyether-polyester-polyamide block copolymer and a synthesis method thereof, and belongs to the field of materials. The invention provides a block copolymer elastomer material taking polycaprolactam as a hard segment and polyether and polyester as soft segments, and specific sulfonic acid groups are introduced to meet specific applications. According to the invention, caprolactam, 6-aminocaproic acid, aliphatic dibasic acid, aliphatic diamine, polyether glycol, sulfonate grafted polyester polyol BY-3305 and the like are used as raw materials, and macromolecular sulfonate grafted polyester polyol BY-3305 is used as a sulfonate grafting agent, so that the reaction efficiency is higher than that of a small molecular monomer containing a sulfonic acid group, and fewer reaction byproducts are generated; the polymerization reaction can be smoothly carried out. The sulfonate grafted polyether-polyester-polyamide block copolymer elastomer is obtained through one-step melt polymerization, and has the advantages of being simple and convenient in synthesis method, low in production cost, high in strength, adjustable in performance and the like.

The invention belongs to the field of industrial application of microalgae, and provides a method for improving astaxanthin produced by haematococcus pluvialis. Comprising the following steps: 1, culturing haematococcus pluvialis to a logarithmic phase; 2, the haematococcus pluvialis is diluted to a proper concentration, and a seed solution for producing astaxanthin from the haematococcus pluvialis is prepared; 3, respectively adding six pre-prepared inducers including creatine, glycine, 6-aminocaproic acid, glutamic acid, L-hydroxyproline and L-cysteine into the prepared haematococcus pluvialis liquid for induction; and 4, continuously filling sterile air into the haematococcus pluvialis liquid added with the inducer in a photobioreactor, culturing, and inducing haematococcus pluvialis cells to accumulate astaxanthin. The invention discloses a method for improving astaxanthin produced by haematococcus pluvialis. The haematococcus pluvialis can be promoted to accumulate a large amount of astaxanthin, and the production cycle of the astaxanthin is shortened. The method is easy to operate, high in efficiency, low in cost and completely suitable for industrial culture of haematococcus pluvialis.

The invention relates to a compound tropicamide eye drop and a preparation method thereof, the compound tropicamide eye drop is composed of tropicamide, phenylephrine hydrochloride, boric acid, sorbitol, aminocaproic acid, a pH regulator and water for injection, more auxiliary materials such as an antioxidant are not needed, and in addition, the stability of the obtained compound tropicamide eye drop is also remarkably improved.

The invention relates to a metal oxide loaded monatomic Ru catalyst and a preparation method and application thereof, the preparation method comprises the following steps: mixing salt of metal M with a grinding aid, and then carrying out ball milling to obtain a metal oxide precursor; calcining the metal oxide precursor to obtain a metal oxide MOx; and dissolving the metal oxide MOx in deionized water, adding a ruthenium source and 6-aminocaproic acid under oil bath heating, mixing, adding sodium borohydride, continuously stirring until the reaction is completed, and then washing and drying to obtain the metal oxide loaded monatomic Ru catalyst Ru SAs / MOx. According to the method, the 6-aminocaproic acid is used for assisting the NaBH4 reduction method, monatomic-scale Ru is constructed on the surface of the metal oxide, high-temperature reducing gas calcination is not needed, the method is simple and rapid, the requirements for equipment and raw materials are low, the economic effect is high, Ru is evenly dispersed on the surface of the oxide carrier and does not form clusters, and a large amount of Ru monatomic loaded oxide carriers can be rapidly prepared.

The present invention provides a preparation method and application of an antimicrobial peptide KAcp targeting Gram-negative bacteria, belonging to the field of biotechnology. Its amino acid sequence is shown in SEQ ID No. 1. The present invention uses a tripeptide repeat sequence: KWKKWK as a template, and two 6-aminohexanoic acids as connectors to increase hydrophobicity to obtain a polypeptide sequence, and then uses a solid phase chemical method to synthesize the polypeptide. The antimicrobial peptide KAcp of the present invention has extremely strong antibacterial ability against Gram-negative bacteria, excellent biocompatibility, and excellent binding ability to lipopolysaccharide. In summary, the antimicrobial peptide KAcp of the present invention has the potential to be developed as an antibacterial drug specifically against Gram-negative bacteria infection, and is expected to become a polypeptide molecular probe specifically targeting Gram-negative bacteria.

The invention provides a treatment method of 6-aminocapronitrile synthesis reaction residues from caprolactam, which comprises the following steps: firstly, feeding the 6-aminocapronitrile synthesis reaction residues from caprolactam and fresh water into a stirred tank reactor for primary hydrolysis reaction, and fixing a catalyst on a stirring paddle through a metal wire mesh; then the reaction liquid and ammonia gas enter a multi-section gas-liquid two-phase tower reactor and sequentially pass through reaction sections filled with metal oxides, molecular sieves and solid base catalysts, and deep hydrolysis of polymers, decomposition of aminocaproic acid and ammonolysis of caprolactam are achieved. According to the method, the hydrolysis rate is larger than or equal to 94%, the yield of 6-aminocapronitrile is larger than or equal to 90%, the method has the advantages of being capable of deeply hydrolyzing residues, simple in process and continuous in operation, the problems of insufficient hydrolysis and intermittent operation in the prior art are solved, the solid waste discharge amount in the hexamethylenediamine production process is greatly reduced, cost is reduced, economic benefits are improved, and the method is suitable for industrial production. A guarantee is provided for green, environment-friendly and safe production.

The present invention provides an easily dyeable and antioxidant nylon filament and a preparation method thereof, belonging to the technical field of nylon. Porous silica nanospheres coated with polydopamine are copolymerized with a silane coupling agent and an antioxidant coupling agent of 3,5-di-tert-butyl-4-hydroxystyrene acid, and graphene oxide is coated on the surface. Then it is added to caprolactam, and 6-aminocaproic acid is added. The mixture is heated, stirred under reduced pressure, discharged, cooled, dried, sliced to obtain nylon chips, and then through melt extrusion, spinning, cooling, oiling, drawing and setting, winding to obtain the easily dyeable and antioxidant nylon filament. The easily dyeable and antioxidant nylon 66 filament fiber of the present invention has the advantages of good heat-oxidation aging resistance, easy adsorption of colorant molecules, easy dyeing, high strength, good rigidity, impact resistance, oil and chemical resistance, wear resistance and self-lubrication, etc., especially better hardness, rigidity, heat resistance and creep properties.

An ophthalmic product in which an ophthalmic composition containing (A) hyaluronic acid or a salt thereof, (B) chlorhexidine, and (C) [epsilon]-aminocaproic acid or a salt thereof is accommodated in a container sterilized with an electron beam or gamma ray.

The invention belongs to the field of medicines, and particularly relates to application of 6-amido-alpha-aminocaproic acid in preparation of medicines for preventing and / or treating pulmonary fibrosis, and the 6-amido-alpha-aminocaproic acid is a compound with a structure as shown in a formula 1 and pharmaceutically acceptable salt or ester thereof; formula 1; r is alkyl with 1 to 4 carbon atoms. The innovative research shows that the structure of the formula 1 can effectively prevent and treat pulmonary fibrosis.

This invention belongs to the field of biomedicine and relates to a procoagulant polypeptide TPTX and its applications. The procoagulant polypeptide TPTX of this invention can exert its procoagulant and hemostatic effects by specifically inhibiting plasmin activity. Experiments have shown that TPTX exhibits significant dose-dependent procoagulant and hemostatic effects in ferric chloride-induced mouse carotid artery thrombosis models, mouse liver hemorrhage models, mouse tail hemorrhage models, and mouse saphenous vein hemorrhage models, with effects superior to the positive control drug 6-aminocaproic acid. Simultaneously, TPTX can reduce the area of ​​atorvastatin-induced cerebral hemorrhage in zebrafish and improve their motor dysfunction. Mechanistic studies show that TPTX has an inhibitory constant Ki of 17.76 nM on plasmin and has no significant effect on the activity of seven other key serine proteases in the coagulation system, demonstrating a clear target and high selectivity. The procoagulant polypeptide of this invention can be used to prepare hemostatic drugs, possessing the advantages of high efficiency, clear target, and high selectivity, with broad prospects for clinical application.

The invention relates to sodium hyaluronate eye drops and a preparation method thereof. Every 1000 ml of the eye drops contain 1 g of sodium hyaluronate, sorbitol and nicotinamide, preferably, 2.8 g of sorbitol, 1.2 g of nicotinamide, 2 g of aminocaproic acid, 0.1 g of edetate disodium, 1.6 g of potassium chloride and 6.8 g of sodium chloride, the sodium hyaluronate eye drops prepared according to the prescription process have extremely high quality stability, the effectiveness of medication is improved, and the sodium hyaluronate eye drops are suitable for clinical application. The method is obviously superior to the prior art.

The invention relates to TAT-PO1 and application of TAT-PO1 in treatment of neurodegenerative disease amyotrophic lateral sclerosis. The polypeptide is connected with a TAT sequence (SEQ ID NO.1) and a PO1 sequence (SEQ ID NO.2) through aminocaproic acid (AHX), and the amino acid sequence of the polypeptide is as follows: YGRKKRRQRRR {AHX} RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. The TAT-PO1 can competitively block the interaction between the PGAM5 and the OMA1, so that the pathological mechanism of the ALS is intervened. The polypeptide TAT-PO1 disclosed by the invention can be prepared into a medicine, and directly targets a central nervous system through intrathecal injection or intravenous administration, so that a new strategy is provided for ALS treatment. In addition, the design thought can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, and a technical normal form is provided for development of related drugs.

The invention provides a method for detecting plasmin activity in ultra-high-temperature sterilized cow milk, the detection method comprises the step of pretreating the ultra-high-temperature sterilized cow milk to obtain a clear and transparent sample solution, the pretreatment comprises the following steps: mixing the ultra-high-temperature sterilized cow milk with a trisodium citrate buffer solution, adjusting the pH value to 8.2, and centrifuging to remove fat, and mixing the degreased cow milk with a detection buffer solution containing epsilon-aminocaproic acid, so that plasmin is separated from casein. According to the preparation method, casein is dissociated by adding trisodium citrate, then the pH value is adjusted to 8.2, and centrifugal degreasing is performed, so that the floating speed of fat is increased, plasmin on the surface (oil-water interface) of the fat is promoted to be released into whey, and a clear solution is obtained; by adding epsilon-aminocaproic acid, plasmin is fully separated from casein, competitive inhibition of casein on a synthetic substrate is reduced, and accurate determination of plasmin activity in UHT milk with low plasmin activity is realized.

The present invention relates to a novel process for the preparation of a crystalline polymorph of sodium neridronate in hemihydrate form F, comprising the following steps: a) reacting 6-aminocaproic acid with a mixture of phosphorous acid and methanesulfonic acid at a temperature in the range of 60°C to 80°C under stirring until a clear solution is obtained; b) adding phosphorus trichloride to the solution of step (a) at a temperature in the range of 60°C to 80°C under stirring; c) diluting the reaction mixture obtained from the previous step (b) with water and heating the water-diluted mixture at a temperature in the range of 80°C to 120°C; d) cooling the heated mixture obtained in step (c) until room temperature, diluting it with water and then slowly adding aqueous sodium hydroxide solution until a pH in the range from 4.2 to 4.6, to obtain a neutralized solution; e) bringing the neutralized solution of step (d) to a temperature of about 70°C and then subjecting it to a temperature increase in the range from 70°C to 140°C until at least 70% of the initial volume of the neutralized solution of step (d) evaporates, thereby obtaining a suspension that will remain under stirring for at least 1 hour; f) cooling the suspension of step (e) until a temperature in the range from about 5°C to 25°C; and g) recovering crystalline sodium neridronate in hemihydrate form F by filtering the suspension in the previous step (f). The process is particularly simple, scalable and environmentally sustainable.

The invention relates to the field of nylon composite materials, and discloses a preparation method of an in-situ polymerization hydrophobic wear-resistant nylon composite material, which comprises the following steps of: adopting caprolactam, aminocaproic acid, fluorosilane modified nano silicon dioxide dispersion liquid, diamino polysiloxane, adipic acid, maleic anhydride grafted polydimethylsiloxane, 9, 10-di-tert-butyl-4-methyl-1, 3, 4-trimethyl-1, 3-pentanediol monoisobutyrate, dioctyl phthalate, dioctyl sebacate, the nylon composite material is prepared by carrying out polymerization reaction on 2, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide and a catalyst, and the nylon composite material has hydrophobic, wear-resistant and aging-resistant effects. Compared with blending modification, the method has the advantages that the modifier is dispersed more uniformly; according to the method, by adding the 9, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide, the dosage of the fluorosilane modified nano silicon dioxide dispersion liquid and the bis-amino polysiloxane can be remarkably reduced, and the negative influence of inorganic filler on the impact resistance of the nylon composite material is remarkably reduced.

The invention discloses a liver-protecting kudzu vine root composition and a preparation method and application thereof in the field of medicinal chemistry, and the liver-protecting kudzu vine root composition comprises a kudzu vine root extract, silymarin, a salvia miltiorrhiza extract, vitamins and two traditional Chinese medicine modified raw materials, the two modified raw materials are respectively an ester derivative formed by puerarin and aminobutyric acid and an ester derivative formed by glycyrrhizic acid and aminocaproic acid. The preparation method comprises the following steps: pre-mixing the extracts and the vitamins, adding the two modified raw materials, uniformly mixing, finally adding the pharmaceutic adjuvants, and tabletting and forming. The two modified raw materials are respectively prepared by activating puerarin or glycyrrhizic acid and corresponding aminocarboxylic acid under the action of a specific condensation reagent, condensing and purifying. According to the composition disclosed by the invention, two structurally modified active components are innovatively introduced and have a synergistic effect with a plurality of liver protection raw materials, so that the anti-oxidation, anti-inflammatory and liver protection effects are remarkably enhanced, and the composition can be used for preparing medicines or health-care products for preventing and treating alcoholic liver injury and non-alcoholic fatty liver diseases.

Applicants have developed novel methods and compositions for treating, preventing or ameliorating the effects plant phytopathogen infestation in plants, including of Candidatus Liberibacter spp. the causal agents of citrus greening and potato zebrachip disease. Novel compositions include one or more active agents of aminocaproic acid, carbinoxamine maleate, chloroxylenol, chlorpropamide, cinoxacin, duartin, and cyclopentolate hydrochloride as well as their derivatives, or salt / acid forms thereof. Methods of preventing disease development and infestation by plant pathogens are disclosed as well as methods of making, using and producing such compositions.

The invention discloses a paper-based fluorescent test paper and a preparation method and application thereof, wherein PAN NFM is activated by carbodiimide and succinimide, and then 6-aminocaproic acid and electrospun PAN NFM are chemically grafted and modified under mild conditions at room temperature, and Zr-MOG is further in situ grown on the surface of the modified 6-ACA-PAN NFM under mild reaction conditions to obtain a test paper with excellent blue fluorescence performance. In actual detection, the fluorescence response of the fluorescent test paper Zr-MOG@6-ACA-PAN NFM to DOX is quickly completed within 10 seconds, and the visual detection limit is as low as 787.5ppb.

The present invention belongs to the technical field of multifunctional new materials, and relates to a poly-6-aminocaproic acid / hyaluronic acid-based multifunctional composite hydrogel and its preparation method and application. Hyaluronic acid modified with hydrazide, hyaluronic acid modified with aldehyde and poly-6-aminocaproic acid modified with dopamine are subjected to a pre-crosslinking reaction. After the reaction is completed, the reaction system is immersed in a strontium chloride aqueous solution to stabilize the structure. The dopamine-modified thiol-terminated poly-aminocaproic acid of the present invention dissociates H in an aqueous medium. + , and hydrazide-modified hyaluronic acid showed the ability to absorb free H + , showing the behavior of changing the pH value of the aqueous medium. The glycopeptide-based hydrogel prepared by the present invention has good mechanical properties, rapid gelation behavior and biocompatibility, and has excellent anti-inflammatory and antibacterial properties.

The invention relates to the field of food, and provides a method for extracting lactoferrin and preparing cheese, cheese and cheese whey, and the method comprises the following steps: performing cream separation on raw milk to obtain single cream and skimmed milk; mixing the skimmed milk with epsilon-aminocaproic acid, and carrying out ion exchange chromatography to obtain lactoferrin and lactoferrin-removed skimmed milk; performing standardization and heating sterilization on the lactoferrin-removed skimmed milk and single cream to obtain a sterilized product; mixing the sterilized product, a leavening agent and calcium lactate, and performing pre-fermentation to obtain a pre-fermented product; mixing the pre-fermentation product, chymosin, calcium chloride and sodium dihydrogen phosphate, and performing curding to obtain a curded product; removing whey from the curd product to obtain clots and cheese whey; and performing mature heap brewing, blanching stretching, cooling forming and after-ripening on the clots to obtain the cheese. By means of the method, high-yield and high-activity lactoferrin can be obtained, meanwhile, the prepared cheese is good in flavor, taste and stability, cheese whey is closer to whey in raw milk, and the nutritive value is high.

A hemostatic dressing comprising chitosan with a degree of deacetylation greater than 80% is disclosed. The dressing is in the form of an uncompressed porous sponge. The manufacturing process involves dissolving chitosan (101) in an organic acid selected from acetic acid, lactic acid, hydrochloric acid, or combinations thereof, followed by incorporation of optional components such as biomaterials (e.g., collagen, gelatin), inorganic salts (e.g., aluminum chloride, ferric sulfate, aluminum sulfate), and synthetic agents (e.g., aminocaproic acid). The solution (102) is subjected to a controlled lyophilization cycle (103) comprising a rapid freezing step (≤4 hours) and primary drying under vacuum (17 hours), resulting in a total freeze-drying cycle of approximately 21 hours. The process preserves the porous microstructure, enhancing absorption efficiency (105%) and reducing time to achieve complete hemostasis to under 220 seconds. The dressing prevents re-bleeding and remains stable under physiological conditions, demonstrating suitability for surgical and emergency medical applications.

The invention discloses a method for depolymerizing nylon 6 waste into an aminocaproic acid monomer, which comprises the following steps: dispersing the crushed nylon 6 waste into a hydrogen peroxide aqueous solution, adding a titanium silicalite molecular sieve, heating and stirring to depolymerize the nylon 6 to obtain a depolymerization product containing the aminocaproic acid monomer; the mass concentration of the hydrogen peroxide aqueous solution is 0.8%-2.4%; the mass ratio of the titanium silicalite molecular sieve to the nylon 6 waste is (0.02-0.1): 1; the heating temperature is controlled to be 70-90 DEG C. According to the method provided by the invention, the nylon 6 waste can be depolymerized, the reaction condition is mild, the method has the characteristics of low reaction temperature and low pressure, the preparation process is simple and easy to operate, the production cost can be greatly reduced, and the method can be effectively applied to depolymerization of the nylon 6 waste.

The invention discloses a cyhalofop-butyl hapten as well as a preparation method and application thereof, and belongs to the technical field of biochemical engineering. According to the cyhalofop-butyl hapten, butanol of a cyhalofop-butyl chemical structure is changed into 6-aminocaproic acid, almost all the structures of the cyhalofop-butyl are reserved, the cyhalofop-butyl hapten has an active group carboxyl coupled with protein, and after the cyhalofop-butyl hapten is coupled with carrier protein, an organism can generate an antibody capable of recognizing the cyhalofop-butyl with high titer and high specificity. The hapten compound disclosed by the invention is simple and convenient in synthesis method and relatively high in purity, and the prepared anti-cyhalofop-butyl monoclonal antibody is very high in sensitivity and can be simultaneously used for carrying out rapid and accurate immunodetection and immunoassay on cyhalofop-butyl and cyhalofop oxalic acid.

Applicants have developed novel methods and compositions for treating, preventing or ameliorating the effects plant phytopathogen infestation in plants, including of Candidatus Liberibacter spp. the causal agents of citrus greening and potato zebrachip disease. Novel compositions include one or more active agents of aminocaproic acid, carbinoxamine maleate, chloroxylenol, chlorpropamide, cinoxacin, duartin, and cyclopentolate hydrochloride as well as their derivatives, or salt / acid forms thereof. Methods of preventing disease development and infestation by plant pathogens are disclosed as well as methods of making, using and producing such compositions.

The invention belongs to the technical field of biomedical examination and determination, and particularly relates to a method and a reagent for detecting the fibrinogen content of whole blood or plasma. The reagent comprises a buffer solution, inorganic salt, amino acid, thrombin, a stabilizer, a thrombin inhibitor, a blood clot enhancer, a heparin substance inhibitor and a preservative; the concentration of the thrombin is 5 U / mL to 200 U / mL; the thrombin inhibitor is one or more of argatroban, hirudin, lepiludine, bivalirudin, dextran sulfate and benzamidine hydrochloride; the blood clot reinforcing agent is one or more of tranexamic acid, aminomethylbenzoic acid, aminocaproic acid, alpha2-AP, TAFI, alpha2-M, PAI-1, PAI-2, glycoprotein rich in histidine (HRG) and C1-INH. According to the application, the reaction time of thrombin and fibrinogen is prolonged through the thrombin inhibitor so as to realize detection of whole blood and plasma samples, and meanwhile, the blood clot enhancement can be effectively increased through the blood clot enhancer without influencing the detection of fibrinogen.

The invention relates to the technical field of pharmaceutical preparations, and discloses a formoterol fumarate inhalation solution and a preparation method thereof. The formoterol fumarate inhalation solution provided by the invention is prepared from the following components in mass concentration: 0.05 percent to 0.2 percent of sodium hydroxide, 0.6 percent to 1.0 percent of tartaric acid, 0.1 percent to 0.3 percent of aminocaproic acid, 0.001 percent to 0.1 percent of polysorbate 20, 0.0009 percent to 0.0011 percent of formoterol fumarate, 0.7 percent to 0.9 percent of sodium chloride and the balance of water for injection. By adjusting the pH value of the solution, adding the polysorbate 20 and the aminocaproic acid, controlling the raw materials and the dissolving temperature thereof, filling nitrogen in the dissolving process and the filling process, and combining filtration and sterilization, the invention provides a method for improving the stability of the product under the condition of controlling the impurity level of the product. And the preparation method can be used for industrially producing the formoterol fumarate inhalation solution.

The invention belongs to the field of drug synthesis, and specifically relates to a method for preparing high-purity 6-aminocaproic acid, which is obtained by Fenton oxidation method using 2-(2-aminoethyl)cyclobutane-1-one as a raw material; the method has simple reaction, convenient operation and convenient post-processing; the raw materials of the preparation method of the invention are easy to obtain, no ion exchange resin is needed, the production cost is greatly reduced, and no subsequent treatment of three wastes is needed. The reaction conditions are mild, the obtained 6-aminocaproic acid has high purity and high yield, the yield can reach more than 95.5%, and the HPLC purity exceeds 98.0%, which is suitable for large-scale production.

The application discloses a preparation method of a Pd / FeAlO3 catalyst for H2 low-temperature catalytic combustion, and relates to the field of synthesis of novel hydrogen combustion catalysts. The application firstly constructs a FeAlO3 carrier, and then loads Pd nanoparticles. In the preparation of the FeAlO3, the solvent of 6-aminocaproic acid is replaced by n-hexane instead of water. In the subsequent reaction, the n-hexane and the aqueous solution form a special two-dimensional phase interface as a soft template. The Pd nanoparticles are carried by the two-dimensional structure soft template, and a better active catalyst can be formed.