17 results about "Aminocaproic acid" patented technology

The invention relates to the technical field of metal working fluids, in particular to a degradable environment-friendly vegetable oil-based semi-synthetic cutting fluid and a preparation method thereof. The cutting fluid comprises 20-30 parts of vegetable lubricating oil, 10-20 parts of an alkali storage agent, 2-5 parts of a corrosion inhibitor, 3-5 parts of a coupling agent, 5-8 parts of a surfactant and 6-11 parts of a composite anti-rust agent, the composite anti-rust agent comprises an anti-rust agent A and an anti-rust agent B, the anti-rust agent A comprises N-[3-(dimethylamino) propyl]-N, N-dimethylformamide, and the anti-rust agent B comprises N-[3-(dimethylamino) propyl]-N, N-dimethylformamide. The antirust agent A comprises at least one of N, N ', N'-trimethyl-1, 3-propanediamine, benzotriazole, sebacic acid and 2, 4, 6-tri (aminocaproic acid)-1, 3, 5-triazine, and the antirust agent B comprises at least one of an imidazoline compound and fatty acid sarcosine ester. The cutting fluid provided by the invention has excellent corrosion resistance, rust resistance, defoaming property, biodegradability and storage stability, and has a good application prospect.

The invention provides a treatment method of 6-aminocapronitrile synthesis reaction residues from caprolactam, which comprises the following steps: firstly, feeding the 6-aminocapronitrile synthesis reaction residues from caprolactam and fresh water into a stirred tank reactor for primary hydrolysis reaction, and fixing a catalyst on a stirring paddle through a metal wire mesh; then the reaction liquid and ammonia gas enter a multi-section gas-liquid two-phase tower reactor and sequentially pass through reaction sections filled with metal oxides, molecular sieves and solid base catalysts, and deep hydrolysis of polymers, decomposition of aminocaproic acid and ammonolysis of caprolactam are achieved. According to the method, the hydrolysis rate is larger than or equal to 94%, the yield of 6-aminocapronitrile is larger than or equal to 90%, the method has the advantages of being capable of deeply hydrolyzing residues, simple in process and continuous in operation, the problems of insufficient hydrolysis and intermittent operation in the prior art are solved, the solid waste discharge amount in the hexamethylenediamine production process is greatly reduced, cost is reduced, economic benefits are improved, and the method is suitable for industrial production. A guarantee is provided for green, environment-friendly and safe production.

The invention belongs to the field of medicines, and particularly relates to application of 6-amido-alpha-aminocaproic acid in preparation of medicines for preventing and / or treating pulmonary fibrosis, and the 6-amido-alpha-aminocaproic acid is a compound with a structure as shown in a formula 1 and pharmaceutically acceptable salt or ester thereof; formula 1; r is alkyl with 1 to 4 carbon atoms. The innovative research shows that the structure of the formula 1 can effectively prevent and treat pulmonary fibrosis.

This invention belongs to the field of biomedicine and relates to a procoagulant polypeptide TPTX and its applications. The procoagulant polypeptide TPTX of this invention can exert its procoagulant and hemostatic effects by specifically inhibiting plasmin activity. Experiments have shown that TPTX exhibits significant dose-dependent procoagulant and hemostatic effects in ferric chloride-induced mouse carotid artery thrombosis models, mouse liver hemorrhage models, mouse tail hemorrhage models, and mouse saphenous vein hemorrhage models, with effects superior to the positive control drug 6-aminocaproic acid. Simultaneously, TPTX can reduce the area of ​​atorvastatin-induced cerebral hemorrhage in zebrafish and improve their motor dysfunction. Mechanistic studies show that TPTX has an inhibitory constant Ki of 17.76 nM on plasmin and has no significant effect on the activity of seven other key serine proteases in the coagulation system, demonstrating a clear target and high selectivity. The procoagulant polypeptide of this invention can be used to prepare hemostatic drugs, possessing the advantages of high efficiency, clear target, and high selectivity, with broad prospects for clinical application.

The invention relates to TAT-PO1 and application of TAT-PO1 in treatment of neurodegenerative disease amyotrophic lateral sclerosis. The polypeptide is connected with a TAT sequence (SEQ ID NO.1) and a PO1 sequence (SEQ ID NO.2) through aminocaproic acid (AHX), and the amino acid sequence of the polypeptide is as follows: YGRKKRRQRRR {AHX} RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. The TAT-PO1 can competitively block the interaction between the PGAM5 and the OMA1, so that the pathological mechanism of the ALS is intervened. The polypeptide TAT-PO1 disclosed by the invention can be prepared into a medicine, and directly targets a central nervous system through intrathecal injection or intravenous administration, so that a new strategy is provided for ALS treatment. In addition, the design thought can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, and a technical normal form is provided for development of related drugs.

The invention relates to the field of nylon composite materials, and discloses a preparation method of an in-situ polymerization hydrophobic wear-resistant nylon composite material, which comprises the following steps of: adopting caprolactam, aminocaproic acid, fluorosilane modified nano silicon dioxide dispersion liquid, diamino polysiloxane, adipic acid, maleic anhydride grafted polydimethylsiloxane, 9, 10-di-tert-butyl-4-methyl-1, 3, 4-trimethyl-1, 3-pentanediol monoisobutyrate, dioctyl phthalate, dioctyl sebacate, the nylon composite material is prepared by carrying out polymerization reaction on 2, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide and a catalyst, and the nylon composite material has hydrophobic, wear-resistant and aging-resistant effects. Compared with blending modification, the method has the advantages that the modifier is dispersed more uniformly; according to the method, by adding the 9, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide, the dosage of the fluorosilane modified nano silicon dioxide dispersion liquid and the bis-amino polysiloxane can be remarkably reduced, and the negative influence of inorganic filler on the impact resistance of the nylon composite material is remarkably reduced.

The invention discloses a liver-protecting kudzu vine root composition and a preparation method and application thereof in the field of medicinal chemistry, and the liver-protecting kudzu vine root composition comprises a kudzu vine root extract, silymarin, a salvia miltiorrhiza extract, vitamins and two traditional Chinese medicine modified raw materials, the two modified raw materials are respectively an ester derivative formed by puerarin and aminobutyric acid and an ester derivative formed by glycyrrhizic acid and aminocaproic acid. The preparation method comprises the following steps: pre-mixing the extracts and the vitamins, adding the two modified raw materials, uniformly mixing, finally adding the pharmaceutic adjuvants, and tabletting and forming. The two modified raw materials are respectively prepared by activating puerarin or glycyrrhizic acid and corresponding aminocarboxylic acid under the action of a specific condensation reagent, condensing and purifying. According to the composition disclosed by the invention, two structurally modified active components are innovatively introduced and have a synergistic effect with a plurality of liver protection raw materials, so that the anti-oxidation, anti-inflammatory and liver protection effects are remarkably enhanced, and the composition can be used for preparing medicines or health-care products for preventing and treating alcoholic liver injury and non-alcoholic fatty liver diseases.

Applicants have developed novel methods and compositions for treating, preventing or ameliorating the effects plant phytopathogen infestation in plants, including of Candidatus Liberibacter spp. the causal agents of citrus greening and potato zebrachip disease. Novel compositions include one or more active agents of aminocaproic acid, carbinoxamine maleate, chloroxylenol, chlorpropamide, cinoxacin, duartin, and cyclopentolate hydrochloride as well as their derivatives, or salt / acid forms thereof. Methods of preventing disease development and infestation by plant pathogens are disclosed as well as methods of making, using and producing such compositions.

The invention relates to the field of food, and provides a method for extracting lactoferrin and preparing cheese, cheese and cheese whey, and the method comprises the following steps: performing cream separation on raw milk to obtain single cream and skimmed milk; mixing the skimmed milk with epsilon-aminocaproic acid, and carrying out ion exchange chromatography to obtain lactoferrin and lactoferrin-removed skimmed milk; performing standardization and heating sterilization on the lactoferrin-removed skimmed milk and single cream to obtain a sterilized product; mixing the sterilized product, a leavening agent and calcium lactate, and performing pre-fermentation to obtain a pre-fermented product; mixing the pre-fermentation product, chymosin, calcium chloride and sodium dihydrogen phosphate, and performing curding to obtain a curded product; removing whey from the curd product to obtain clots and cheese whey; and performing mature heap brewing, blanching stretching, cooling forming and after-ripening on the clots to obtain the cheese. By means of the method, high-yield and high-activity lactoferrin can be obtained, meanwhile, the prepared cheese is good in flavor, taste and stability, cheese whey is closer to whey in raw milk, and the nutritive value is high.

A hemostatic dressing comprising chitosan with a degree of deacetylation greater than 80% is disclosed. The dressing is in the form of an uncompressed porous sponge. The manufacturing process involves dissolving chitosan (101) in an organic acid selected from acetic acid, lactic acid, hydrochloric acid, or combinations thereof, followed by incorporation of optional components such as biomaterials (e.g., collagen, gelatin), inorganic salts (e.g., aluminum chloride, ferric sulfate, aluminum sulfate), and synthetic agents (e.g., aminocaproic acid). The solution (102) is subjected to a controlled lyophilization cycle (103) comprising a rapid freezing step (≤4 hours) and primary drying under vacuum (17 hours), resulting in a total freeze-drying cycle of approximately 21 hours. The process preserves the porous microstructure, enhancing absorption efficiency (105%) and reducing time to achieve complete hemostasis to under 220 seconds. The dressing prevents re-bleeding and remains stable under physiological conditions, demonstrating suitability for surgical and emergency medical applications.

The invention discloses a method for depolymerizing nylon 6 waste into an aminocaproic acid monomer, which comprises the following steps: dispersing the crushed nylon 6 waste into a hydrogen peroxide aqueous solution, adding a titanium silicalite molecular sieve, heating and stirring to depolymerize the nylon 6 to obtain a depolymerization product containing the aminocaproic acid monomer; the mass concentration of the hydrogen peroxide aqueous solution is 0.8%-2.4%; the mass ratio of the titanium silicalite molecular sieve to the nylon 6 waste is (0.02-0.1): 1; the heating temperature is controlled to be 70-90 DEG C. According to the method provided by the invention, the nylon 6 waste can be depolymerized, the reaction condition is mild, the method has the characteristics of low reaction temperature and low pressure, the preparation process is simple and easy to operate, the production cost can be greatly reduced, and the method can be effectively applied to depolymerization of the nylon 6 waste.

Applicants have developed novel methods and compositions for treating, preventing or ameliorating the effects plant phytopathogen infestation in plants, including of Candidatus Liberibacter spp. the causal agents of citrus greening and potato zebrachip disease. Novel compositions include one or more active agents of aminocaproic acid, carbinoxamine maleate, chloroxylenol, chlorpropamide, cinoxacin, duartin, and cyclopentolate hydrochloride as well as their derivatives, or salt / acid forms thereof. Methods of preventing disease development and infestation by plant pathogens are disclosed as well as methods of making, using and producing such compositions.

The application discloses a preparation method of a Pd / FeAlO3 catalyst for H2 low-temperature catalytic combustion, and relates to the field of synthesis of novel hydrogen combustion catalysts. The application firstly constructs a FeAlO3 carrier, and then loads Pd nanoparticles. In the preparation of the FeAlO3, the solvent of 6-aminocaproic acid is replaced by n-hexane instead of water. In the subsequent reaction, the n-hexane and the aqueous solution form a special two-dimensional phase interface as a soft template. The Pd nanoparticles are carried by the two-dimensional structure soft template, and a better active catalyst can be formed.

The invention discloses a high-performance aqueous zinc battery electrolyte, a preparation method thereof and a zinc battery. The electrolyte comprises a basic electrolyte and an additive 6-aminocaproic acid, wherein the basic electrolyte is composed of zinc salt and deionized water. The preparation method is simple and comprises the following steps: dissolving the zinc salt in the deionized water to form a basic solution, adding the 6-aminocaproic acid, and stirring until the 6-aminocaproic acid is completely dissolved. The formed zinc ion battery comprises the electrolyte, a positive plate, a negative plate and a diaphragm. 6-aminocaproic acid can be dissociated in the electrolyte, amino can optimize a zinc ion solvation structure, carboxyl is beneficial to formation of a stable electrode-electrolyte interface layer, dendritic crystal growth and hydrogen evolution reaction can be inhibited through the synergistic effect, the cycle stability of the battery is remarkably improved, and the service life of the battery is remarkably prolonged. Experiments show that the Zn / / Zn symmetric battery adopting the electrolyte can realize ultra-long circulation under harsh conditions. The method is simple and convenient in process, low in cost and environment-friendly, and provides a new way for development of safe and long-life zinc batteries.

An object of the present invention is to provide a novel glycation stress inhibitor having an activity of inhibiting glycation stress occurring in vivo.SOLUTION: The glycation stress inhibitor, the glycation reaction inhibitor or the inflammatory reaction inhibitor for inhibiting the inflammatory reaction caused by AGEs contains one or more kinds selected from the group consisting of glycyrrhizic acids, allantoins, azulenes, pyridoxine hydrochloride, hinokitiols, copper chlorophylls, lysozyme chloride and epsilon-aminocaproic acid. Each agent is useful as an external preparation, an agent for oral cavity, a gingival care agent, and a periodontal disease preventive agent.SELECTED DRAWING: None

The application discloses an amino hexanoic acid injection and a preparation method thereof, and belongs to the technical field of medicines.The technical problem to be solved is to provide an amino hexanoic acid injection with lower initial impurities, higher high-temperature stability, better light stability and better freeze-thaw stability.The technical solution is characterized in that the amino hexanoic acid injection comprises amino hexanoic acid, ectoine, a pH regulator and water for injection, and the pH of the amino hexanoic acid injection is 6.0-7.6.

The disclosure provides polypeptides and encoding nucleic acids of engineered carboxylic acid reductases and / or engineered alcohol dehydrogenases. The disclosure also provides cells expressing an engineered form of the carboxylic acid reductases and / or engineered alcohol dehydrogenases. The disclosure further provides methods for producing a bioderived compound, such as 1,6 hexanediol (HDO), hexamethylenediamine (HMD), upstream precursors (e.g., adipate semi-aldehyde, 6-aminocaproic acid, 6-aminocaproate semialdehyde, 6-hydroxyhexanoic acid, 6-aminohexanol, caprolactone, caprolactam, and / or 6- hydroxyhexanal), and products derived therefrom comprising culturing cells expressing an engineered carboxylic acid reductase and / or engineered alcohol dehydrogenases.