48 results about "Aminocaproic acid" patented technology

The invention discloses a copper ion carrier material with a photothermal effect, a preparation method and an anti-cancer drug formed by the copper ion carrier material, and belongs to the technical field of nano drug loading technologies, and the structural formula of the copper ion carrier material is as follows: # imgabs0 #. The preparation method comprises the following steps: S1, mixing butanedione and concentrated hydrochloric acid in water, stirring and reacting, adding 4-methyl thiosemicarbazide, continuously stirring and reacting, and performing post-treatment to obtain a compound (4); then dissolving the compound (3) and 4, 4-dimethyl thiourea in a DMSO solvent, dropwise adding glacial acetic acid for reaction, and performing post-treatment to obtain a compound (6); dissolving the compound (6) and 6-aminocaproic acid in an acetonitrile solvent, reacting, and performing post-treatment to obtain a compound (8); and dissolving the compound (8) and beta-cyclodextrin in a DMSO solvent, mixing, adding an activating agent and a condensing agent, reacting, and performing post-treatment to obtain the copper ion carrier material with the photothermal effect. The problems that a copper ion carrier is poor in water solubility, low in photothermal conversion efficiency and low in near-infrared light energy, ultraviolet light is not prone to penetrating into tissues, and tissue damage can be caused are solved.

The invention relates to the technical field of metal working fluids, in particular to a degradable environment-friendly vegetable oil-based semi-synthetic cutting fluid and a preparation method thereof. The cutting fluid comprises 20-30 parts of vegetable lubricating oil, 10-20 parts of an alkali storage agent, 2-5 parts of a corrosion inhibitor, 3-5 parts of a coupling agent, 5-8 parts of a surfactant and 6-11 parts of a composite anti-rust agent, the composite anti-rust agent comprises an anti-rust agent A and an anti-rust agent B, the anti-rust agent A comprises N-[3-(dimethylamino) propyl]-N, N-dimethylformamide, and the anti-rust agent B comprises N-[3-(dimethylamino) propyl]-N, N-dimethylformamide. The antirust agent A comprises at least one of N, N ', N'-trimethyl-1, 3-propanediamine, benzotriazole, sebacic acid and 2, 4, 6-tri (aminocaproic acid)-1, 3, 5-triazine, and the antirust agent B comprises at least one of an imidazoline compound and fatty acid sarcosine ester. The cutting fluid provided by the invention has excellent corrosion resistance, rust resistance, defoaming property, biodegradability and storage stability, and has a good application prospect.

The invention relates to the technical field of microorganisms, and particularly discloses a recombinant microorganism and application thereof in production of hexamethylenediamine. Compared with an original strain, the recombinant microorganism disclosed by the invention expresses a carboxylic acid reductase CAR variant, a CAR activating enzyme sfp and putrescine transaminase patA; the amino acid sequence of the carboxylic acid reductase CAR variant is as shown in SEQ ID NO. 28; preferably, adipic acid transporters DcaK and DcaP, acyl CoA transferases DcaI and DcaJ, an acylated succinate semialdehyde dehydrogenase sucD, and a 4-aminobutyric acid transaminase gabT are also expressed. By utilizing the recombinant microorganism, 6-aminocaproic acid / adipic acid can be efficiently converted into hexamethylenediamine, and a new method is provided for green biosynthesis of hexamethylenediamine.

The invention discloses a sulfonate grafted polyether-polyester-polyamide block copolymer and a synthesis method thereof, and belongs to the field of materials. The invention provides a block copolymer elastomer material taking polycaprolactam as a hard segment and polyether and polyester as soft segments, and specific sulfonic acid groups are introduced to meet specific applications. According to the invention, caprolactam, 6-aminocaproic acid, aliphatic dibasic acid, aliphatic diamine, polyether glycol, sulfonate grafted polyester polyol BY-3305 and the like are used as raw materials, and macromolecular sulfonate grafted polyester polyol BY-3305 is used as a sulfonate grafting agent, so that the reaction efficiency is higher than that of a small molecular monomer containing a sulfonic acid group, and fewer reaction byproducts are generated; the polymerization reaction can be smoothly carried out. The sulfonate grafted polyether-polyester-polyamide block copolymer elastomer is obtained through one-step melt polymerization, and has the advantages of being simple and convenient in synthesis method, low in production cost, high in strength, adjustable in performance and the like.

The invention belongs to the field of industrial application of microalgae, and provides a method for improving astaxanthin produced by haematococcus pluvialis. Comprising the following steps: 1, culturing haematococcus pluvialis to a logarithmic phase; 2, the haematococcus pluvialis is diluted to a proper concentration, and a seed solution for producing astaxanthin from the haematococcus pluvialis is prepared; 3, respectively adding six pre-prepared inducers including creatine, glycine, 6-aminocaproic acid, glutamic acid, L-hydroxyproline and L-cysteine into the prepared haematococcus pluvialis liquid for induction; and 4, continuously filling sterile air into the haematococcus pluvialis liquid added with the inducer in a photobioreactor, culturing, and inducing haematococcus pluvialis cells to accumulate astaxanthin. The invention discloses a method for improving astaxanthin produced by haematococcus pluvialis. The haematococcus pluvialis can be promoted to accumulate a large amount of astaxanthin, and the production cycle of the astaxanthin is shortened. The method is easy to operate, high in efficiency, low in cost and completely suitable for industrial culture of haematococcus pluvialis.

The invention relates to the technical field of flame-retardant cutting agents, in particular to a preparation method and application of an environment-friendly flame-retardant cooling agent. Comprising the following steps: 1, carrying out an esterification reaction on 2, 2, 2-trichloroethanol and 2, 4, 6-tri (aminocaproic acid)-1, 3, 5-triazine to obtain a triazine polycarboxylic acid ester; (2) grafting the triazine polycarboxylic acid ester and DOPO (9, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide) to obtain triazine polycarboxylic acid ester-DOPO; (3) under an alkaline condition, carrying out a hydrolysis reaction on the triazine polycarboxylic acid ester-DOPO, and then carrying out acidizing treatment to obtain triazine polycarboxylic acid-DOPO; step two, (1) reacting hydroxyl-terminated fluorosilicone oil with epoxy chloropropane, and epoxidizing the hydroxyl-terminated fluorosilicone oil to obtain epoxy-terminated fluorosilicone oil; (2) reacting the epoxy-terminated fluorosilicone oil with diethylenetriamine to obtain hyperbranched hydrophilic fluorosilicone oil; and 3, mixing the triazine polycarboxylic acid-DOPO, the hyperbranched hydrophilic fluorosilicone oil and other raw materials to obtain the environment-friendly flame-retardant coolant.

The invention relates to a compound tropicamide eye drop and a preparation method thereof, the compound tropicamide eye drop is composed of tropicamide, phenylephrine hydrochloride, boric acid, sorbitol, aminocaproic acid, a pH regulator and water for injection, more auxiliary materials such as an antioxidant are not needed, and in addition, the stability of the obtained compound tropicamide eye drop is also remarkably improved.

The invention discloses water-based metal antirust powder with ultralow use concentration. The water-based metal antirust powder comprises the following components in percentage by mass: 25-50% of anhydrous sodium tetraborate, 0-10% of sodium carbonate, 20-25% of sodium hydroxide, 5-10% of polybasic carboxylic acid (one or more of the polybasic carboxylic acid) and 30% of aza-benzene ring polyaminocaproic acid. Wherein the polybasic carboxylic acid is one or more of dodecanedioic acid, sebacic acid, tridecanedioic acid and 2, 4, 6-tri (aminocaproic acid)-1, 3, 5-triazine, the aza-benzene ring polyaminocaproic acid is a tetrabasic acid, and the synthetic method of the tetrabasic carboxylic acid metal antirust agent is introduced in detail in the patent CN201910984891.1. The preparation method comprises the following steps: firstly mixing 5-10% of polycarboxylic acid and 20-30% of aza-benzene ring polyaminocaproic acid, uniformly stirring, then adding 0-10% of sodium carbonate, uniformly stirring, then adding 25-50% of anhydrous sodium tetraborate, uniformly stirring, finally adding 20-25% of sodium hydroxide, uniformly stirring to obtain the water-based metal antirust powder, and packaging to obtain the water-based metal antirust powder.

The invention relates to a metal oxide loaded monatomic Ru catalyst and a preparation method and application thereof, the preparation method comprises the following steps: mixing salt of metal M with a grinding aid, and then carrying out ball milling to obtain a metal oxide precursor; calcining the metal oxide precursor to obtain a metal oxide MOx; and dissolving the metal oxide MOx in deionized water, adding a ruthenium source and 6-aminocaproic acid under oil bath heating, mixing, adding sodium borohydride, continuously stirring until the reaction is completed, and then washing and drying to obtain the metal oxide loaded monatomic Ru catalyst Ru SAs / MOx. According to the method, the 6-aminocaproic acid is used for assisting the NaBH4 reduction method, monatomic-scale Ru is constructed on the surface of the metal oxide, high-temperature reducing gas calcination is not needed, the method is simple and rapid, the requirements for equipment and raw materials are low, the economic effect is high, Ru is evenly dispersed on the surface of the oxide carrier and does not form clusters, and a large amount of Ru monatomic loaded oxide carriers can be rapidly prepared.

The present invention provides a preparation method and application of an antimicrobial peptide KAcp targeting Gram-negative bacteria, belonging to the field of biotechnology. Its amino acid sequence is shown in SEQ ID No. 1. The present invention uses a tripeptide repeat sequence: KWKKWK as a template, and two 6-aminohexanoic acids as connectors to increase hydrophobicity to obtain a polypeptide sequence, and then uses a solid phase chemical method to synthesize the polypeptide. The antimicrobial peptide KAcp of the present invention has extremely strong antibacterial ability against Gram-negative bacteria, excellent biocompatibility, and excellent binding ability to lipopolysaccharide. In summary, the antimicrobial peptide KAcp of the present invention has the potential to be developed as an antibacterial drug specifically against Gram-negative bacteria infection, and is expected to become a polypeptide molecular probe specifically targeting Gram-negative bacteria.

The invention provides a treatment method of 6-aminocapronitrile synthesis reaction residues from caprolactam, which comprises the following steps: firstly, feeding the 6-aminocapronitrile synthesis reaction residues from caprolactam and fresh water into a stirred tank reactor for primary hydrolysis reaction, and fixing a catalyst on a stirring paddle through a metal wire mesh; then the reaction liquid and ammonia gas enter a multi-section gas-liquid two-phase tower reactor and sequentially pass through reaction sections filled with metal oxides, molecular sieves and solid base catalysts, and deep hydrolysis of polymers, decomposition of aminocaproic acid and ammonolysis of caprolactam are achieved. According to the method, the hydrolysis rate is larger than or equal to 94%, the yield of 6-aminocapronitrile is larger than or equal to 90%, the method has the advantages of being capable of deeply hydrolyzing residues, simple in process and continuous in operation, the problems of insufficient hydrolysis and intermittent operation in the prior art are solved, the solid waste discharge amount in the hexamethylenediamine production process is greatly reduced, cost is reduced, economic benefits are improved, and the method is suitable for industrial production. A guarantee is provided for green, environment-friendly and safe production.

The present invention relates to a high-adhesion wear-resistant coating for a road roller and a preparation method thereof, and belongs to the technical field of coatings. A preparation method for a high-adhesion wear-resistant coating for a road roller comprises the following steps: after mixing the mixed particles in anhydrous ethanol, adding a coupling agent for constant temperature treatment, centrifuging to obtain solids, washing with alcohol, and placing in an oven for vacuum drying to obtain pretreated composite particles; after mixing the pretreated composite particles and anhydrous ethanol, adding a modified monomer and an initiator, stirring and mixing, and then irradiating with ultraviolet light, filtering and washing with alcohol, placing in an oven for vacuum drying to obtain a prefabricated material; in an inert atmosphere, adding caprolactam, hexamethylenediamine, terephthalic acid, aminocaproic acid and the prefabricated material to a reactor for constant temperature treatment, adding an auxiliary agent for blending, and obtaining the coating. The coating prepared by the present invention has excellent adhesion, corrosion resistance and mechanical properties.

The present invention provides an easily dyeable and antioxidant nylon filament and a preparation method thereof, belonging to the technical field of nylon. Porous silica nanospheres coated with polydopamine are copolymerized with a silane coupling agent and an antioxidant coupling agent of 3,5-di-tert-butyl-4-hydroxystyrene acid, and graphene oxide is coated on the surface. Then it is added to caprolactam, and 6-aminocaproic acid is added. The mixture is heated, stirred under reduced pressure, discharged, cooled, dried, sliced to obtain nylon chips, and then through melt extrusion, spinning, cooling, oiling, drawing and setting, winding to obtain the easily dyeable and antioxidant nylon filament. The easily dyeable and antioxidant nylon 66 filament fiber of the present invention has the advantages of good heat-oxidation aging resistance, easy adsorption of colorant molecules, easy dyeing, high strength, good rigidity, impact resistance, oil and chemical resistance, wear resistance and self-lubrication, etc., especially better hardness, rigidity, heat resistance and creep properties.

An ophthalmic product in which an ophthalmic composition containing (A) hyaluronic acid or a salt thereof, (B) chlorhexidine, and (C) [epsilon]-aminocaproic acid or a salt thereof is accommodated in a container sterilized with an electron beam or gamma ray.

The present invention relates to the use of JWA polypeptide in the preparation of an anti-tumor drug synergist. The amino acid sequence of the polypeptide is shown in I or II: I: FPGSDRF-Z; II: X-FPGSDRF-Z; wherein the amino acid S is phosphorylated, X and Z are amino acids or amino acid sequences respectively; X is selected from one of F, (R)9, (R)9-F, 6-aminocaproic acid, 6-aminocaproic acid-F, 6-aminocaproic acid-(R)9, and 6-aminocaproic acid-(R)9-F; and Z is selected from one of (G) n ‑RGD, A‑(G) n ‑RGD, n is an integer greater than or equal to 0, and the value range of n is 0-10. The above polypeptide can improve the hypoxia state of the tumor microenvironment, promote the normalization of tumor blood vessels to inhibit the initiation and occurrence of tumor metastasis, increase the effective perfusion of drugs in the tumor, and can be used as an anti-tumor drug synergist to provide new clinical drug possibilities for the treatment of tumors.

The invention belongs to the field of medicines, and particularly relates to application of 6-amido-alpha-aminocaproic acid in preparation of medicines for preventing and / or treating pulmonary fibrosis, and the 6-amido-alpha-aminocaproic acid is a compound with a structure as shown in a formula 1 and pharmaceutically acceptable salt or ester thereof; formula 1; r is alkyl with 1 to 4 carbon atoms. The innovative research shows that the structure of the formula 1 can effectively prevent and treat pulmonary fibrosis.

The invention provides an easy-to-dye antioxidant nylon filament and a preparation method thereof, and belongs to the technical field of nylon. The preparation method comprises the following steps: coupling porous silicon dioxide nanospheres coated and modified by polydopamine with an antioxidant of a silane coupling agent copolymerized with 3, 5-di-tert-butyl-4-hydroxystyrene acid, coating the surface with graphene oxide, adding into caprolactam, adding aminocaproic acid, heating, reducing pressure, stirring, reacting, discharging, cooling, drying and slicing to obtain nylon slices; and carrying out melt extrusion, spinning, cooling, oiling, drafting and shaping, and winding to obtain the easy-to-dye antioxidant nylon filament. The easy-to-dye antioxidant nylon 66 filament fiber has the advantages of good thermo-oxidative aging resistance, easy adsorption of pigment molecules, easy dyeing, high strength, good rigidity, impact resistance, oil resistance, chemical resistance, wear resistance, self-lubrication and the like, and especially has better hardness, rigidity, heat resistance and creep resistance.

This invention belongs to the field of biomedicine and relates to a procoagulant polypeptide TPTX and its applications. The procoagulant polypeptide TPTX of this invention can exert its procoagulant and hemostatic effects by specifically inhibiting plasmin activity. Experiments have shown that TPTX exhibits significant dose-dependent procoagulant and hemostatic effects in ferric chloride-induced mouse carotid artery thrombosis models, mouse liver hemorrhage models, mouse tail hemorrhage models, and mouse saphenous vein hemorrhage models, with effects superior to the positive control drug 6-aminocaproic acid. Simultaneously, TPTX can reduce the area of ​​atorvastatin-induced cerebral hemorrhage in zebrafish and improve their motor dysfunction. Mechanistic studies show that TPTX has an inhibitory constant Ki of 17.76 nM on plasmin and has no significant effect on the activity of seven other key serine proteases in the coagulation system, demonstrating a clear target and high selectivity. The procoagulant polypeptide of this invention can be used to prepare hemostatic drugs, possessing the advantages of high efficiency, clear target, and high selectivity, with broad prospects for clinical application.

The invention relates to sodium hyaluronate eye drops and a preparation method thereof. Every 1000 ml of the eye drops contain 1 g of sodium hyaluronate, sorbitol and nicotinamide, preferably, 2.8 g of sorbitol, 1.2 g of nicotinamide, 2 g of aminocaproic acid, 0.1 g of edetate disodium, 1.6 g of potassium chloride and 6.8 g of sodium chloride, the sodium hyaluronate eye drops prepared according to the prescription process have extremely high quality stability, the effectiveness of medication is improved, and the sodium hyaluronate eye drops are suitable for clinical application. The method is obviously superior to the prior art.

The invention belongs to the technical field of chemical medicines, and relates to a method for preparing 6-nitrocaproic acid from aminocaproic acid. The method for preparing 6-nitrocaproic acid by using aminocaproic acid comprises the following steps: S1, obtaining a liquid containing aminocaproic acid; s2, adding an oxide into the liquid containing aminocaproic acid, and reacting at 40-70 DEG C for 8-72 hours; s3, carrying out alcohol precipitation and filtering to remove aminocaproic acid in the mixture liquid obtained in the step S2; s4, carrying out liquid phase separation on a product obtained in the step S3, and collecting an effluent obtained by eluting a chromatographic column acetonitrile aqueous solution for 17.5-20 minutes; and S5, drying the product in the step S4 to obtain a light brown oily substance. The invention further relates to the 6-nitrocaproic acid prepared from the aminocaproic acid injection and application of the 6-nitrocaproic acid, the technical blank that the 6-nitrocaproic acid is not prepared from the aminocaproic acid injection is filled, and a basis is provided for safety research of the aminocaproic acid injection.

The invention relates to TAT-PO1 and application of TAT-PO1 in treatment of neurodegenerative disease amyotrophic lateral sclerosis. The polypeptide is connected with a TAT sequence (SEQ ID NO.1) and a PO1 sequence (SEQ ID NO.2) through aminocaproic acid (AHX), and the amino acid sequence of the polypeptide is as follows: YGRKKRRQRRR {AHX} RHIFLIRHSQYHVDGSLEKDRTLTPLGREQAE. The TAT-PO1 can competitively block the interaction between the PGAM5 and the OMA1, so that the pathological mechanism of the ALS is intervened. The polypeptide TAT-PO1 disclosed by the invention can be prepared into a medicine, and directly targets a central nervous system through intrathecal injection or intravenous administration, so that a new strategy is provided for ALS treatment. In addition, the design thought can also be applied to other neurodegenerative diseases caused by abnormal protein interaction, and a technical normal form is provided for development of related drugs.

The invention provides a method for detecting plasmin activity in ultra-high-temperature sterilized cow milk, the detection method comprises the step of pretreating the ultra-high-temperature sterilized cow milk to obtain a clear and transparent sample solution, the pretreatment comprises the following steps: mixing the ultra-high-temperature sterilized cow milk with a trisodium citrate buffer solution, adjusting the pH value to 8.2, and centrifuging to remove fat, and mixing the degreased cow milk with a detection buffer solution containing epsilon-aminocaproic acid, so that plasmin is separated from casein. According to the preparation method, casein is dissociated by adding trisodium citrate, then the pH value is adjusted to 8.2, and centrifugal degreasing is performed, so that the floating speed of fat is increased, plasmin on the surface (oil-water interface) of the fat is promoted to be released into whey, and a clear solution is obtained; by adding epsilon-aminocaproic acid, plasmin is fully separated from casein, competitive inhibition of casein on a synthetic substrate is reduced, and accurate determination of plasmin activity in UHT milk with low plasmin activity is realized.

The present invention relates to a novel process for the preparation of a crystalline polymorph of sodium neridronate in hemihydrate form F, comprising the following steps: a) reacting 6-aminocaproic acid with a mixture of phosphorous acid and methanesulfonic acid at a temperature in the range of 60°C to 80°C under stirring until a clear solution is obtained; b) adding phosphorus trichloride to the solution of step (a) at a temperature in the range of 60°C to 80°C under stirring; c) diluting the reaction mixture obtained from the previous step (b) with water and heating the water-diluted mixture at a temperature in the range of 80°C to 120°C; d) cooling the heated mixture obtained in step (c) until room temperature, diluting it with water and then slowly adding aqueous sodium hydroxide solution until a pH in the range from 4.2 to 4.6, to obtain a neutralized solution; e) bringing the neutralized solution of step (d) to a temperature of about 70°C and then subjecting it to a temperature increase in the range from 70°C to 140°C until at least 70% of the initial volume of the neutralized solution of step (d) evaporates, thereby obtaining a suspension that will remain under stirring for at least 1 hour; f) cooling the suspension of step (e) until a temperature in the range from about 5°C to 25°C; and g) recovering crystalline sodium neridronate in hemihydrate form F by filtering the suspension in the previous step (f). The process is particularly simple, scalable and environmentally sustainable.

The invention relates to the field of nylon composite materials, and discloses a preparation method of an in-situ polymerization hydrophobic wear-resistant nylon composite material, which comprises the following steps of: adopting caprolactam, aminocaproic acid, fluorosilane modified nano silicon dioxide dispersion liquid, diamino polysiloxane, adipic acid, maleic anhydride grafted polydimethylsiloxane, 9, 10-di-tert-butyl-4-methyl-1, 3, 4-trimethyl-1, 3-pentanediol monoisobutyrate, dioctyl phthalate, dioctyl sebacate, the nylon composite material is prepared by carrying out polymerization reaction on 2, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide and a catalyst, and the nylon composite material has hydrophobic, wear-resistant and aging-resistant effects. Compared with blending modification, the method has the advantages that the modifier is dispersed more uniformly; according to the method, by adding the 9, 10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide, the dosage of the fluorosilane modified nano silicon dioxide dispersion liquid and the bis-amino polysiloxane can be remarkably reduced, and the negative influence of inorganic filler on the impact resistance of the nylon composite material is remarkably reduced.

The invention discloses a liver-protecting kudzu vine root composition and a preparation method and application thereof in the field of medicinal chemistry, and the liver-protecting kudzu vine root composition comprises a kudzu vine root extract, silymarin, a salvia miltiorrhiza extract, vitamins and two traditional Chinese medicine modified raw materials, the two modified raw materials are respectively an ester derivative formed by puerarin and aminobutyric acid and an ester derivative formed by glycyrrhizic acid and aminocaproic acid. The preparation method comprises the following steps: pre-mixing the extracts and the vitamins, adding the two modified raw materials, uniformly mixing, finally adding the pharmaceutic adjuvants, and tabletting and forming. The two modified raw materials are respectively prepared by activating puerarin or glycyrrhizic acid and corresponding aminocarboxylic acid under the action of a specific condensation reagent, condensing and purifying. According to the composition disclosed by the invention, two structurally modified active components are innovatively introduced and have a synergistic effect with a plurality of liver protection raw materials, so that the anti-oxidation, anti-inflammatory and liver protection effects are remarkably enhanced, and the composition can be used for preparing medicines or health-care products for preventing and treating alcoholic liver injury and non-alcoholic fatty liver diseases.

Applicants have developed novel methods and compositions for treating, preventing or ameliorating the effects plant phytopathogen infestation in plants, including of Candidatus Liberibacter spp. the causal agents of citrus greening and potato zebrachip disease. Novel compositions include one or more active agents of aminocaproic acid, carbinoxamine maleate, chloroxylenol, chlorpropamide, cinoxacin, duartin, and cyclopentolate hydrochloride as well as their derivatives, or salt / acid forms thereof. Methods of preventing disease development and infestation by plant pathogens are disclosed as well as methods of making, using and producing such compositions.

The present invention belongs to the field of drug synthesis, and is particularly related to a novel method for preparing 6-aminocaproic acid using pimelic acid as a raw material, using pimelic acid with abundant sources as a reaction raw material, undergoing acylation and cyclization reaction with acetic anhydride, and then undergoing substitution reaction with ammonia, and finally purifying after ring opening in an alkaline system to obtain 6-aminocaproic acid pure product. The reaction process is simple and post-processing is convenient; acetic anhydride is added in excess, and during the reaction process, acetic anhydride serves as both a reaction raw material and a reaction reagent, ensuring that the reaction can proceed in a positive direction and improving the conversion rate; the 6-aminocaproic acid obtained by the present invention has a purity of more than 97%, a yield of more than 85%, and is suitable for large-scale production.

The present invention provides an amphiphilic molecule for targeted regulation of tumor angiogenesis, belonging to the field of functional polypeptide nanotechnology, wherein the amphiphilic molecule includes a hydrophilic end and a hydrophobic end, wherein the hydrophilic end is an anti-angiogenic polypeptide, wherein the N-terminus of the anti-angiogenic polypeptide is connected to 6-aminocaproic acid by an amide bond, and the other end of the 6-aminocaproic acid is connected to the hydrophobic end, and the hydrophobic end is 3-diethylaminopropyl isothiocyanate. The amphiphilic molecule can be used as a drug carrier to extend the half-life of anti-tumor drugs, and has a tumor site-specific response, responds to the release of drugs under the weakly acidic microenvironment of the tumor, and enables the drug to be efficiently transported to the tumor site, and the amphiphilic molecule can also target and inhibit tumor angiogenesis, and synergistically improve the efficacy of anti-tumor drugs. The present invention also provides an acid-responsive polypeptide nanodrug targeting tumor tissue.

The invention discloses a paper-based fluorescent test paper and a preparation method and application thereof, wherein PAN NFM is activated by carbodiimide and succinimide, and then 6-aminocaproic acid and electrospun PAN NFM are chemically grafted and modified under mild conditions at room temperature, and Zr-MOG is further in situ grown on the surface of the modified 6-ACA-PAN NFM under mild reaction conditions to obtain a test paper with excellent blue fluorescence performance. In actual detection, the fluorescence response of the fluorescent test paper Zr-MOG@6-ACA-PAN NFM to DOX is quickly completed within 10 seconds, and the visual detection limit is as low as 787.5ppb.

The present invention belongs to the technical field of multifunctional new materials, and relates to a poly-6-aminocaproic acid / hyaluronic acid-based multifunctional composite hydrogel and its preparation method and application. Hyaluronic acid modified with hydrazide, hyaluronic acid modified with aldehyde and poly-6-aminocaproic acid modified with dopamine are subjected to a pre-crosslinking reaction. After the reaction is completed, the reaction system is immersed in a strontium chloride aqueous solution to stabilize the structure. The dopamine-modified thiol-terminated poly-aminocaproic acid of the present invention dissociates H in an aqueous medium. + , and hydrazide-modified hyaluronic acid showed the ability to absorb free H + , showing the behavior of changing the pH value of the aqueous medium. The glycopeptide-based hydrogel prepared by the present invention has good mechanical properties, rapid gelation behavior and biocompatibility, and has excellent anti-inflammatory and antibacterial properties.