A kind of beta-glucosidase improved mutant e168q and its coding gene and application
A technology of glucosidase and mutant, applied in the field of genetic engineering and genetic engineering, can solve the problem of high cost
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0034] Cloning of embodiment 1 high catalytic efficiency β-glucosidase mutant coding gene A-E168Q
[0035] The present invention takes the acid β-glucosidase (its amino acid sequence as SEQ ID NO.3) derived from the thermophilic fungus Talaromyces leycettanus JCM12802 as the parent, and uses molecular biology techniques to carry out the acid β-glucosidase sequence Expression after region replacement.
[0036] SEQ ID NO.3 is as follows:
[0037] YGFGGSGWDAAYGRAKAALNKLNQTEKVGIVTGVKWMGGPCVGNTYKPSSIDYPSLCLQDSPLGVRFANPVTAFPAGINAGATWDRSLINARGAAMGAEAKGLGVNVQLGPVAGPLGKNPNSGRIWEGFSNDPYLSGVAMEETIAGMQGSGVQACAKHYIGNEQEHNRETISSNIDDRTLHELYVWPFMNAVKANVASVMCSYNEVNGSWSCENDALLNGLLKTELGFPGYIMSDWNAQHTTVNSANSGLDMTMPGSDFNNPPGSIYWGPNLEAAVANGSVPQSRLDDMVTRILASWYLVGQDEGYPPVAFSSWNGGKANVDVTGDHKSVVRAVARDSIVLLKNDNNALPLRKPKSLAIIGQDATVNPAGPNACSDRGCDTGTLAMGWGSGTAQFPYIVGPLDAIQSQAAADGTNITTSTTDDTTAAASAAASAGTAIVFINSDSGEGYITVEGNAGDRNNLDPWHNGNELVQAVAAVNKNVIVVVHSVGPVILEAILAQPNVKAIVWPGLPGQESGNALVDVLYGSTSPSGKLPYTIAKQF...
Embodiment 2
[0041] Example 2 Preparation of β-glucosidase mutants with high catalytic efficiency.
[0042] The expression vector pPIC9r was subjected to double enzyme digestion (EcoR I+Not I), and at the same time, the gene A-E168Q encoding the high catalytic efficiency β-glucosidase mutant was double enzyme digested (EcoR I+Not I), and the cut code was mature The gene fragment of the high catalytic efficiency β-glucosidase mutant was connected with the expression vector pPIC9r to obtain the recombinant plasmid pPIC9r-A-E168Q containing the high catalytic efficiency β-glucosidase mutant gene A-E168Q and transformed into Pichia pastoris GS115, The recombinant yeast strain GS115 / A-E168Q was obtained.
[0043] Take the GS115 strain containing the recombinant plasmid, inoculate it in a 1L Erlenmeyer flask with 300mL of BMGY medium, place it at 30°C, and culture it on a shaker at 220rpm for 48h; then centrifuge the culture solution at 3000g for 5min, discard the supernatant, and use 100mL of 0...
Embodiment 3
[0045] Example 3 Activity Analysis of Recombinant High Catalytic Efficiency β-Glucosidase Mutant and Wild Type
[0046] Determination of β-glucosidase activity: the amount of the product p-nitrophenol (pNP) generated by enzymatic hydrolysis of the substrate pNPG was measured at 405 nm.
[0047] Reaction steps: Mix 125μl 2mM pNPG substrate with 125μl buffer, add 250μl appropriately diluted enzyme solution, react at 75°C for 10min, add 1.5mL 1M Na 2 CO 3 Terminate the reaction and measure the OD using a spectrophotometer 405 value.
[0048] Definition of enzyme activity unit: 1 β-glucosidase activity unit (U) is defined as the amount of enzyme required to decompose the substrate pNPG to generate 1 μmol p-nitrophenol (pNP) per minute under given reaction conditions.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


