FRET (Fluorescence Resonance Energy Transfer) quantitative detection and correction method based on simultaneous separation of excitation spectrum and emission spectrum
A technology of emission spectroscopy and quantitative detection, which is applied in the field of fluorescence resonance energy transfer quantitative detection, and can solve the problems of large FRET efficiency value and so on.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0054] 1. Plasmid source
[0055] The donor fluorescent group is the gene-encoded fluorescent protein Cerulean (referred to as C), and the acceptor is the gene-encoded fluorescent protein Venus (referred to as V). Referring to the tandem C32V plasmid, it is composed of a 32-amino acid link sequence (TSGLETRDIRSENLYFQGPREFPGGTAGPVAT) that links C and V. , with reference to the tandem CTV plasmid that is Cerulean-TRAF-Venus, wherein TRAF is a receptor-associated factor domain of a long-chain tumor necrosis factor comprising 229 amino acids; the tandem plasmid CVC (Cerulean-5-Venus-5-Cerulean) to be tested contains Two donors C and one acceptor V, C and V are connected by 5 amino acid sequences, these plasmids were purchased from the US addgene plasmid bank [Koushik S V, Blank P S, Vogel S S. Anomalous surplus energy transfer observed with multiple FRET acceptors[J].PloS one,2009,4(11):e8031].
[0056] 2. Wide-field spectral microscopy imaging system
[0057] The wide-field flu...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 



