Chimeric antigen receptor based on GD2 and application thereof
A technology of chimeric antigen receptors and antigens, which is applied in the field of tumor cell immunotherapy, can solve problems such as difficult to accurately enter tumor tissue, cannot exist in the body for a long time, and increases the difficulty of retreatment, achieving good results and safety. Immunity-stimulating effect, reducing the risk of storms
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0070] Example 1: Construction of Chimeric Antigen Receptor (I)
[0071] (1) Synthesize Secretory signal peptide, GD2 antigen binding domain, CD28 extracellular and transmembrane domain, CD28 intracellular signaling domain and 4-1BB signaling domain, CD3ζ signaling domain, 2A sequence through whole gene synthesis and caspase 9 domains, such as figure 1 As shown, namely Secretory-GD2scFv-CD28-4-1BB-CD3ζ-2A-FBKP.Casp9;
[0072] The amino acid sequence of the chimeric antigen receptor, SEQ ID NO.12, is as follows:
[0073] MLLLVTSLLLCELPHPAFLLIPQVQLVESGPGVVQPGRSLRISCAVSGFSVTNYGVHWVRQPPGKGLEWLGVIWAGGITNYNSAFMSRLTISKDNSKNTVYLQMNSLRAEDTAMYYCASRGGHYGYALDYWGQGTLVTVSSGSTSGSGKPGSSEGSTKGEIVMTQTPATLSVSAGERVTITCKASQSVSNDVTWYQQKPGQAPRLLIYSASNRYSGVPARFSGSGYGTEFTFTISSVQSEDFAVYFCQQDYSSFGQGTKLEIKAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASGGGGSGGGGSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELGGGGSGGGGSGGGGSRVKFSRSADAPAYQQGQNQL...
Embodiment 2
[0074]Example 2: Construction of Chimeric Antigen Receptor (II)
[0075] (1) Synthesize Secretory signal peptide, GD2 antigen binding domain, CD28 extracellular and transmembrane domain, CD28 signaling domain and 4-1BB signaling domain, CD3ζ signaling domain, 2A sequence and cysteine domain through whole gene synthesis Caspase 9 domain, namely Secretory-GD2scFv-CD28-4-1BB-CD3ζ-2A-FBKP.Casp9;
[0076] The amino acid sequence of the chimeric antigen receptor, SEQ ID NO.13, is as follows:
[0077] MLLLVTSLLLCELPEVQLVQSGAEVEKPGASVKISCKASGSSFTGYNMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRATLTVDKSTSTAYMHLKSLRSEDTAVYYCVSGMEYWGQGTSVTVSSGSTSGSGKPGSSEGSTKGDVVMTQTPLSLPVTPGEPASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELKAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASGGGGSGGGGSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELGGGGSGGGGSGGGGSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR...
Embodiment 3
[0078] Example 3: Construction of Chimeric Antigen Receptor (III)
[0079] (1) Synthesize Secretory signal peptide, GD2 antigen binding domain, CD28 extracellular and transmembrane domain, CD28 signaling domain and 4-1BB signaling domain, CD3ζ signaling domain, 2A sequence and cysteine domain through whole gene synthesis Caspase 9 domain, namely Secretory-GD2scFv-CD28-4-1BB-CD3ζ-2A-FBKP.Casp9;
[0080] The amino acid sequence of the chimeric antigen receptor, SEQ ID NO.14, is as follows:
[0081] MLLLVTSLLLCELPAFLLIPEVKLVESGGGLVLPGDSLRLSCATSEFTFTDYYMTWVRQPPRKALEWLGFIRNRANGYTTEYNPSVKGRFTISRDNSQSILYLQMNTLRTEDSATYYCARVSNWAFDYWGQGTTLTVSSGSTSGSGKPGSSEGSTKGDVVMTQTPLSLPVSLGDQASISCRSSQSLLKNNGNTFLHWYLQKSGQSPKLLIYKVSNRLSGVPDRFSGSGSGTYFTLKISRVEAEDLGVYFCSQSTHIPYTFGGGTKLEIKAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASGGGGSGGGGSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELGGGGSGGGGSGGGGSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDK...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap