Long-acting oxyntomodulin (OXM) hybrid peptide, preparation method of hybrid peptide and application of hybrid peptide serving as drug

A compound and drug technology, applied in the field of medicinal chemistry, can solve the problems of weak hypoglycemic activity and short half-life, and achieve the effects of long drug effect time, short synthesis cycle and cost saving

Active Publication Date: 2018-12-07
CHINA PHARM UNIV
View PDF7 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Compared with pure GLP-1R agonists, OXM has a better effect in intervening body weight, regulating lipid metabolism, and improving glucose tolerance, but its hypoglycemic activity is relatively weak and its half-life is short

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Long-acting oxyntomodulin (OXM) hybrid peptide, preparation method of hybrid peptide and application of hybrid peptide serving as drug
  • Long-acting oxyntomodulin (OXM) hybrid peptide, preparation method of hybrid peptide and application of hybrid peptide serving as drug
  • Long-acting oxyntomodulin (OXM) hybrid peptide, preparation method of hybrid peptide and application of hybrid peptide serving as drug

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0089] His-Gly-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Met-Asp-Cys-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp- Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH 2 (SEQ.ID NO.1)

[0090] solid phase synthesis

[0091] (1) Swelling of the resin

[0092] Weigh 50mg of Fmoc-Rink amide-MBHA Resin (degree of substitution: 0.4mmol / g), swell with 7mL of DCM for 30min, filter to remove DCM, then swell with 10mL of NMP for 30min, rinse with NMP and 7mL of DCM respectively.

[0093] (2) Removal of Fmoc protecting group

[0094] Put the swollen resin into the reactor, add 25% piperidine / NMP (V / V) solution containing 0.1M HOBt to the resin to remove Fmoc, and wash it with NMP after the reaction. A resin free of the initially attached Fmoc protecting group is obtained.

[0095] (3) Synthesis of Fmoc-Ser(tBu)-Rink amide-MBHA Resin

[0096] Fmoc-Ser(tBu)-OH (15.4 mg, 0.04 mmol), HBTU (15.1 mg, 0.04 mmol), HOBt (5.4 mg, 0.04 mmol) and DIPEA (13.9 μL, 0.08 mmol) were dissolved in N...

Embodiment 2

[0102] His-Gly-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Glu-Cys-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp- Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH 2 (SEQ.ID NO.2)

[0103] The synthesis method was the same as in Example 1, and the collected solution was lyophilized to obtain 29.2 mg of the pure product. The theoretical relative molecular mass is 4269.7. ESI-MS m / z: Calcd.[M+3H] 3+ 1424.2, [M+4H] 4+ 1068.4; Found[M+3H] 3+ 1424.8, [M+4H] 4+ 1068.1.

Embodiment 3

[0105] His-Gly-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Cys-Glu-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp- Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH 2 (SEQ.ID NO.3)

[0106] The synthesis method was the same as in Example 1, and the collected solution was lyophilized to obtain 27.6 mg of the pure product. The theoretical relative molecular mass is 4228.6. ESI-MS m / z: Calcd.[M+3H] 3+ 1410.5, [M+4H] 4+ 1058.2; Found[M+3H] 3+ 1410.0, [M+4H] 4+ 1058.2.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a class of long-acting oxyntomodulin (OXM) hybrid peptides as well as application and synthetic methods of the hybrid peptides. The preparation method comprises the followingsteps: modifying the OXM, and hybridizing with a peptide sequence of Exenatide, thereby obtaining the OXM hybrid peptides with long pharmacologic action time and excellent weight losing effects. Synthesis of target polypeptides is rapidly realized by an orthogonal protection strategy solid-phase synthesis method, and the crude product is purified and freeze-dried so as to obtain the OXM hybrid peptide.

Description

technical field [0001] The invention relates to the field of medicinal chemistry, in particular to long-acting oxyntomodulin (OXM) hybrid peptide, its preparation method and its application as medicine. Background technique [0002] The cause of metabolic syndrome is abnormal metabolism of various substances such as protein, fat and carbohydrates. Overnutrition and reduced physical activity can lead to obesity and obesity-related diseases such as diabetes. In recent years, the incidence of type 2 diabetes and dyslipidemia has been increasing day by day. [0003] Oxyntomodulin (OXM) is a polypeptide composed of 37 amino acids secreted by small intestinal L cells, including the entire 29 amino acid sequence of glucagon and the 8 amino acid part of the C-terminal extension, which is similar to glucagon Peptide-1 (GLP-1) has 50% homology, and the peptide sequence is: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA. OXM can simultaneously activate glucagon-like peptide-1 receptor (GLP-1...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K19/00A61K38/22A61K38/26A61P3/10A61P3/04A61P3/06A61P1/16
CPCA61P1/16A61P3/04A61P3/06A61P3/10C07K14/57563C07K14/605A61K38/00C07K2319/00
Inventor钱海黄文龙蔡星光刘春霞毕昕洲戴雨轩周洁
OwnerCHINA PHARM UNIV