A kind of human interleukin 10-fc fusion protein and its medical application
A technology of interleukin and fusion protein, which is applied in the field of human interleukin 10-Fc fusion protein and its medical application, and can solve the problem of prolonging human interleukin 10-Fc fusion protein and its medical application, product heterogeneity, and half-life Short and other problems, to overcome the troubles of production process and quality control, inhibit tumor growth, increase the effect of stability
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0031] Embodiment 1 of the present invention provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with the Fc fragment of immunoglobulin IgG through a linker peptide; wherein, the Fc fragment is human IgG1 Fc part; the amino acid sequence of human interleukin 10 is shown in SEQ ID No:1; the amino acid sequence of Fc fragment is shown in SEQ ID No:2;
[0032] The general formula of the connecting peptide is [GlyGlyGlyGlySer] 6 , the amino acid sequence of the connecting peptide is shown in SEQ ID No:4.
[0033] Wherein, SEQ ID No: 1 (amino acid sequence of human interleukin 10);
[0034] SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.
[0035] SEQ ID No: 2 (amino acid sequence of Fc fragment);
[0036] DKTHTCPPCPAPELEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKAYACAVSNKALPAPIEKTIS...
Embodiment 2
[0041] Embodiment 2 of the present invention provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with the Fc fragment of immunoglobulin IgG through a linker peptide; wherein, the Fc fragment is human IgG1 Fc part; the amino acid sequence of human interleukin 10 is shown in SEQ ID No:1; the amino acid sequence of Fc fragment is shown in SEQ ID No:3;
[0042] The general formula of the connecting peptide is [GlyGlyGlyGlySer] 6 , the amino acid sequence of the connecting peptide is shown in SEQ ID No:4.
[0043] Wherein, the amino acid sequence provided by SEQ ID No:1 and SEQ ID No:4 is identical to that in Example 1;
[0044] SEQ ID No: 3 (amino acid sequence of Fc fragment);
[0045] EPKSCDKTHTCPPCPAPELEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKAYACAVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK。
[0046] The spe...
Embodiment 3
[0048] Embodiment 3 of the present invention provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with the Fc fragment of immunoglobulin IgG through a linker peptide; wherein, the Fc fragment is human IgG2 Fc part, the amino acid sequence of the Fc fragment is shown in SEQ ID No: 5; the amino acid sequence of human interleukin 10 is shown in SEQ ID No: 1;
[0049] The general formula of the connecting peptide is [GlyGlyGlyGlySer] 6 , the amino acid sequence of the connecting peptide is shown in SEQ ID No:4.
[0050] Wherein, the amino acid sequence provided by SEQ ID No:1 and SEQ ID No:4 is identical to that in Example 1;
[0051] SEQ ID No: 5 (amino acid sequence of Fc fragment);
[0052] ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK。
[0053] The s...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


