Check patentability & draft patents in minutes with Patsnap Eureka AI!

A kind of human interleukin 10-fc fusion protein and its medical application

A technology of interleukin and fusion protein, which is applied in the field of human interleukin 10-Fc fusion protein and its medical application, and can solve the problem of prolonging human interleukin 10-Fc fusion protein and its medical application, product heterogeneity, and half-life Short and other problems, to overcome the troubles of production process and quality control, inhibit tumor growth, increase the effect of stability

Active Publication Date: 2021-10-08
BEIJING DONGFANG BIOTECH
View PDF6 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0005] In order to solve the problems of the short half-life of human IL-10 in the prior art and the inhomogeneous products of human IL-10 after PEGylation, the present invention provides a combination of human IL-10 and immunoglobulin Fc The human interleukin 10-Fc fusion protein and its medical application that the fragments are fused together, retain the biological activity of IL-10, and greatly prolong the half-life of IL-10 in vivo

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of human interleukin 10-fc fusion protein and its medical application
  • A kind of human interleukin 10-fc fusion protein and its medical application
  • A kind of human interleukin 10-fc fusion protein and its medical application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0031] Embodiment 1 of the present invention provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with the Fc fragment of immunoglobulin IgG through a linker peptide; wherein, the Fc fragment is human IgG1 Fc part; the amino acid sequence of human interleukin 10 is shown in SEQ ID No:1; the amino acid sequence of Fc fragment is shown in SEQ ID No:2;

[0032] The general formula of the connecting peptide is [GlyGlyGlyGlySer] 6 , the amino acid sequence of the connecting peptide is shown in SEQ ID No:4.

[0033] Wherein, SEQ ID No: 1 (amino acid sequence of human interleukin 10);

[0034] SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN.

[0035] SEQ ID No: 2 (amino acid sequence of Fc fragment);

[0036] DKTHTCPPCPAPELEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKAYACAVSNKALPAPIEKTIS...

Embodiment 2

[0041] Embodiment 2 of the present invention provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with the Fc fragment of immunoglobulin IgG through a linker peptide; wherein, the Fc fragment is human IgG1 Fc part; the amino acid sequence of human interleukin 10 is shown in SEQ ID No:1; the amino acid sequence of Fc fragment is shown in SEQ ID No:3;

[0042] The general formula of the connecting peptide is [GlyGlyGlyGlySer] 6 , the amino acid sequence of the connecting peptide is shown in SEQ ID No:4.

[0043] Wherein, the amino acid sequence provided by SEQ ID No:1 and SEQ ID No:4 is identical to that in Example 1;

[0044] SEQ ID No: 3 (amino acid sequence of Fc fragment);

[0045] EPKSCDKTHTCPPCPAPELEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKAYACAVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK。

[0046] The spe...

Embodiment 3

[0048] Embodiment 3 of the present invention provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with the Fc fragment of immunoglobulin IgG through a linker peptide; wherein, the Fc fragment is human IgG2 Fc part, the amino acid sequence of the Fc fragment is shown in SEQ ID No: 5; the amino acid sequence of human interleukin 10 is shown in SEQ ID No: 1;

[0049] The general formula of the connecting peptide is [GlyGlyGlyGlySer] 6 , the amino acid sequence of the connecting peptide is shown in SEQ ID No:4.

[0050] Wherein, the amino acid sequence provided by SEQ ID No:1 and SEQ ID No:4 is identical to that in Example 1;

[0051] SEQ ID No: 5 (amino acid sequence of Fc fragment);

[0052] ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK。

[0053] The s...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention relates to the field of biomedicine, and specifically provides a human interleukin 10-Fc fusion protein, which is formed by fusing human interleukin 10 with an Fc fragment of immunoglobulin IgG through a connecting peptide; wherein, The Fc fragment is selected from one of human IgG1, IgG2 or IgG4; the amino acid sequence of the human interleukin 10 is shown in SEQ ID No:1. The present invention is formed by fusion of human IL-10 and human immunoglobulin Fc fragment through a specific connecting peptide, which prolongs the half-life of human IL-10 in vivo and increases its stability in vivo. In addition, the present invention provides The human interleukin 10-Fc fusion protein can be used for the treatment of immune diseases and cancer.

Description

technical field [0001] The invention relates to the technical field of biomedicine, in particular to a human interleukin 10-Fc fusion protein and its medical application. Background technique [0002] The human interleukin 10 (IL-10) gene is located on 1q31-32, with a full length of 5.1 kb and 5 exons. The IL-10 gene is composed of 178 amino acids. Human and mouse IL-10 genes have 75% of the same amino acid sequence. Human IL-10 is a 35KD dimer composed of two monomers through non-covalent There are two disulfide bonds in the monomer to maintain its structure and biological activity. It is currently known that all lymphocytes can synthesize IL-10, and the most important sources in the body are mainly mononuclear macrophages and T helper cells. In addition, dendritic cells, B cells, NK cells, cytotoxic T cells, hypertrophic cells Cells as well as neutrophils and eosinophils also synthesize the IL-10 gene. [0003] Over the years, people's understanding of IL-10 has mainly ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K19/00A61K38/20A61K47/68A61P35/00A61P37/00
CPCC07K14/5428A61P35/00A61P37/00C07K2319/30A61K38/00A61K38/20A61K47/68C07K19/00C07K14/54C07K16/00C12N15/85C07K14/55C12N2800/107
Inventor 白义张稳周建华
Owner BEIJING DONGFANG BIOTECH
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More