Unlock instant, AI-driven research and patent intelligence for your innovation.

Combination of epitope polypeptide and viral vector for inducing immunity

An epitope peptide, carrier technology, applied in the direction of viruses/phages, viruses, viral peptides, etc., can solve the problems of immune cross-reaction and weak protection, and achieve the effect of stable compatibility and balancing cellular and humoral immunity.

Active Publication Date: 2022-06-07
SHANTOU UNIV MEDICAL COLLEGE
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0003] Because there are many types of enteroviruses, the immune cross-reaction and protection between different types of enteroviruses are very weak, so it is difficult to use a single type of vaccine to provide immune protection against a variety of popular enteroviruses

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Combination of epitope polypeptide and viral vector for inducing immunity
  • Combination of epitope polypeptide and viral vector for inducing immunity

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0027](1) Acquisition of gene fragments with SEQ ID No.2:

[0028] Biosynthetics company using whole gene synthesis or long primer splicing to obtain a gene fragment SEQ ID No.2 encoding the epitope polypeptide shown in SEQ ID No.1, which is optimized by codons and has a sequence of: 5'

[0029]

[0030] MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPLLEKVAKEAADEAKAKLEAAGATVTVKEAAAKVPPGAPKPDSRESLAWKKPTFGEHKQEKDLEYGAAAYSMINNIIIRAAYISKFIDWLKGPGPGPASAYQWFYD GYPTFGPGPGVRIYMRMKHVRAWIPKKWQTATNPSVFVKMTDPKKYDGYPTFGEHLQANDLAAYREQGWIIPEAAYEVTWENATFGPGPGWDFGLQSSVTLVVPWGPGPGTAVQVLPTAANTEASKKPTFGEHKQATNLQYGQKKASITTTDYEGGVPANPAAYMINNIIIRAAAYATGIVTIWYGPGPGRPILRTATVQGPSLDHHH HHH；

[0031] (2) Expression of recombinant epitope polypeptide genes: The above obtained epitope polypeptide gene fragments are inserted into the expression vector by PCR by introducing specific enzyme resection sites or Gibson assembly, such as Figure 1 As shown, the ep...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a combination of an epitope polypeptide and a virus carrier for inducing immunity, which belongs to the field of biotechnology; the invention provides an epitope polypeptide derived from various enteroviruses and having biological effects of immune protection. The gene encoding the epitope polypeptide is loaded on the modified Coxsackie B3 virus vector, and the foreign protein can be successfully expressed in the cells after injection; This recombinant epitope polypeptide can more effectively induce immune responses to a variety of viruses; after the epitope polypeptide is combined with the viral vector, the gene fragment encoded by the epitope polypeptide is compatible with the viral vector and has good genetic stability sex.

Description

Technical field [0001] The present invention belongs to the field of biotechnology, specifically relates to a combination of epitope polypeptides for inducing immunity with viral vectors. Background [0002] Enteroviruses are a class of viruses belonging to the genus Enterovirus in the family Micrornaviridae that can infect both children and adults, especially to the health and public health of children. Among them, the viruses of the enterovirus genus that are more threatening to children mainly include neointestinal virus EV71, coxsackievirus A16, coxsackievirus A6, etc. After infecting children, such viruses will cause hand-foot-and-mouth disease, herpetic angina and other diseases, and serious viral infections can cause complications of the central nervous system, including encephalitis, encephalopathy, etc. [0003] Since there are many main pathogenic virus species in the genus enteroviruses, the immune cross-reactivity and protection between different types of enteroviruse...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/085C12N15/41C12N7/01A61K39/125A61P31/14C12R1/93
CPCC07K14/005C12N7/00A61K39/12A61P31/14C12N2770/32322C12N2770/32334C12N2770/32021C12N2770/32034A61K2039/5256A61K2039/70Y02A50/30
Inventor 王革非邓辉雄谷李铭李雁嫘宋鑫利王婷婷何绚婷代剑平李蕊
Owner SHANTOU UNIV MEDICAL COLLEGE