Chimeric antigen receptor targeting ADGRE2 and application thereof
A chimeric antigen receptor and targeting technology, which can be used to target specific cell fusion, polypeptides containing positioning/targeting motifs, applications, etc., can solve problems such as low expression
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0050] The preparation method of CAR-T cells in accordance with an embodiment of the present invention, comprising the step of collecting peripheral blood mononuclear cells; T cells such as CD3 + T cells are selected from the above peripheral blood mononuclear cells; T cells are activated The T cells containing the above nucleic acids were used, and then amplification culture was then carried out.
[0051] In a specific example, retronectin can also be used to improve the infection efficiency of Virus on T cells during infection.
[0052] In a specific example, the preparation method comprises the steps of:
[0053] Peripheral blood mononuclear cells were selected from CD3 + T cells with CD3, transferred to GT-T551 H3 medium to carry out cultures, and the proportion of bearing ratio of 1: 1 was added to the CD3-CD28 stimulating magnetic beads for stimulation. 48h after viral infection;
[0054] The retronectin is packaged in a hole plate, placed in a 37 ° C cell incubator for 2 h;...
Embodiment 1
[0056] Example 1 vector construction
[0057] In this embodiment, a single-chain antibody (SCFV) using anti-human ADGRE2 antibodies is used as an antigen binding domain, combined with signal peptide, hinge region, transmembrane region, a common thorns, and CD3Z intracellular domain, and constructs a chimeric antigen receptor of target ADGRE2. , Schematic figure 1 Indicated. After obtaining the ADGRE2-CAR amino acid sequence, all genetically synthesis of Guangzhou Aiji Biotechnology Co., Ltd. and constructed to a slow viral expression vector.
[0058] ADGRE2-Car protein sequence (482AA):
[0059] / / mdmrvpaqllgllllwlrgarc DIQMTQSPSSLSSSLGGKVTITCRASQDINKFISWYQHRPGKGP Rllihyastlqpgipsrfsgsgsgrdysfsisnlepediatyphyclqydnlwtfggggtkleirggggggggggggggggggg SevqlqqsgpelvkpgasvrmsckasgyTFTDynmywvkqslgkslewigyiyPntcgatynqkfkgkatltvnks SSTAFMELSLTSEDSAVYCGRGGPFAYWGQGTLVTVSATTPAPRPTPAPTISQPLSLRPEACRPAAGGAV HtrgldfacdiyiwaplagtcgvllslvitlyckrgrkkkllyifkqpfMrpvqttqeedgcscrfpeeeeggcel Rvkfsr...
Embodiment 2
[0062] Example 2 Virus Packaging
[0063] Plasmid transfection: Plasmid, PEI, OPTI-MEM medium was placed at room temperature for 5 min; Take OPTI-MEM436 μL in 1.5 MLEP tube, then add 64 μl of PEI to mix, stand for 5 min at room temperature; press 6: 9: 9: 16 PLP1, PLP2, PLP-VSVG, the purpose gene expression plasmid, and OPTI-MEM to 500 μL were added to stand for 5 min at room temperature; the mixed PEI-OPTI-MEM solution was added to the plain-containing OPTI-MEM, and the room temperature was allowed to stand for 20 min; The 1 ml DNA / PEI mixture slowly drops into HEK 293T, gently mixed, incubated at 37 ° C incubation, replace fresh medium after 16 to 18 hours, add 5% CO 2 The 37 ° C incubator continued to incubate.
[0064] Virus collection and concentration: Plasmid was transfected with 48 h, collected by superprint, centrifuged at 4 ° C for 20 min, remove cell debris, and filtered with a 0.45 μm filter to obtain supernatants; 500000 centrifugation 2H, removing the supernatant, ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



