Application of CKAP4 reagent in detection specimen and bladder cancer detection kit
A bladder cancer and kit technology, applied in the field of tumor molecular biology, can solve problems such as poor signal, insufficient detection sensitivity, and inability to achieve statistical differences, and achieve the effect of avoiding missed detection
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0095] Tissue microarrays containing normal, malignant and metastases were purchased from Avilabio (Xi'an, China, DC-Bla11021). Will
Embodiment 2
[0097] Example 2: Using gradient centrifugation to collect exosomes in cell samples.
[0107] Loading: the prepared sample is added to the SDS-PAGE gel, and the electrophoresis program is 70V 35min, 120V 90min. Transfer film
[0109] (10) The antibody was recovered and washed three times with TBST for 10 min each time. Incubate mouse and rabbit antibodies at room temperature for 1 h. Recovered Antibody, TBST
[0112] (1) 5× electrophoresis buffer: 288g, Gly; 60.6g, Tris; 20g, SDS, and finally add deionized water to dilute to 4L. Make
[0113] (2) Transfer liquid: 14.4g, glycine; 3.03g, Tris; 200m, methanol, and finally add deionized water and make up to 1L.
[0117] 10% separating gel and 5% stacking gel. 10% SDS‑PAGE Protein Separation Gel (5mL): In a 50mL centrifuge tube, press
[0119] Transmission electron microscopy (TEM) was used to observe the exosomes of 5637 and SV-HUC-1 cells. will first be able to specifically identify
[0120] The results are shown in Figure 2.
Embodiment 3
[0124] MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQNQAHGKGGH
PUM
| Property | Measurement | Unit |
|---|---|---|
| size | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 


