Compositions and methods for regulating sas1r

a technology of sas1r and sas1b, which is applied in the field of compositions and methods for regulating sas1r, can solve the problems of less success in identifying oolemmal receptors for sperm ligands, and achieve the effect of modulating fertilization and fertility

Inactive Publication Date: 2010-07-22
UNIV OF VIRGINIA ALUMNI PATENTS FOUND
View PDF7 Cites 18 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

[0019]Together, the data disclosed herein demonstrated that SAS1R is a proteolytically active, oocyte and early embryo specific oolemmal metalloprotease receptor for the sperm intra-acrosomal ligand SLLP1 and is a target for regulating fertilization and as a contraceptive. Surprisingly, and importantly, the enzyme is demonstrated herein to show stage specific expression in secondary and subsequent follicular oocytes, including preantral and antral follicles, rendering it a suitable target for a reversible contraceptive that will spare naked, primordial, and primary oocytes, and preserve the ovarian reserve of stem germ cells. Therefore, the invention further encompasses the compositions and methods for identifying compounds that inhibit SAS1R.

Problems solved by technology

Although several sperm proteins that bind to mammalian oocytes have been identified, there has been less success in identifying oolemmal receptors for sperm ligands.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Compositions and methods for regulating sas1r
  • Compositions and methods for regulating sas1r
  • Compositions and methods for regulating sas1r

Examples

Experimental program
Comparison scheme
Effect test

embodiments

[0272]The present invention provides compositions and methods to prevent or inhibit SAS1R function or activity, including the use of SAS1R proteins and fragments and homologs thereof. The present invention further provides compositions and methods utilizing SAS1R, and fragments and homologs thereof, to elicit an immune response against SAS1R. In one aspect, administration of SAS1R or antigenic fragments or homologs thereof results in inhibiting SAS1R. In one aspect, such an immunogenic response and resulting inhibition of SAS1R results in a decrease in fertility.

[0273]The following are useful mammalian SAS1R sequences:

mouse SAS1R Variant 1, 435 residues(SEQ ID NO: 19)MGIMGSLWPWILTMLSLLGLSMGAPSASRCSGVCSTSVPEGFTPEGSPVFQDKDIPAINQGLISEETPESSFLVEGDIIRPSPFRLLSVTNNKWPKGVGGFVEIPFLLSPKYDELSRRVIMDAFAEFERFTCIRFVAYHGQRDFVSILPMAGCFSGVGRSGGMQVVSLAPTCLRKGRGIVLHELMHVLGFWHEHSRADRDRYIQVNWNEILPGFEINFIKSRSTNMLVPYDYSSVMHYGRFAFSWRGQPTIIPLWTSSVHIGQRWNLSTSDITRVCRLYNCSRSVPDSHGRGFEAQSDGSSLTPASISRLQRLLEALSEES...

example 1

[0404]Materials & Methods:

[0405]Identification of SAS1R by SPR: Using purified soluble rSLLP1 as bait, SAS1R was initially identified as a SLLP1 binding partner using mouse oocyte protein lysates.

[0406]Purification of mouse SAS1R and SLLP1: Mature SAS1R (without signal sequence, 414 a.a.) was cloned by PCR from mouse ovary cDNA, expressed in E. coli and purified by affinity column chromatography. SLLP1 was purified as described earlier (2).

[0407]Antibody production and Western analyses: Antibody to purified rSAS1R was raised in guinea pigs. Specificity of the antibody was tested against rSAS1R and mouse oocyte extracts following SDS-PAGE and western blotting using HRP-2nd antibody and TMB substrate.

[0408]IF localization of SAS1R in mouse ovary: Fixed ovary sections were probed with anti-SAS1R antibody followed by Cy3-2nd antibody and imaged with UV-microscopy.

[0409]IF microscopy of oocytes, early embryos and sperm: Zona intact-, zona free oocytes, early embryos and sperm were collec...

example 2

SAS1R as a Target for Contraception

[0475]Effect of SAS1R antibody on mouse in-vitro fertilization. Antibodies and sera directed SAS1R were prepared. Cumulus intact mouse oocytes were incubated with either preimmune or immune sera at 1 / 10 & 1 / 20 (N=4) or 1 / 80 (N=2) dilutions for 45 min followed by insemination with capacitated sperm. The number of two cell embryos was scored as fertilized eggs. The statistical significance between the preimmune and immune sera was calculated by t test assuming equal variances and are presented in FIG. 16. It can be seen that an inhibitor of SAS1R, such as an antibody directed against SAS1R, is an effective inhibitor of fertilization.

[0476]SAS1R is an Effective Immunogen. Next, it was shown that the SAS1R protein is an effective immunogen in females. As an oocyte specific, sperm oolemmal receptor, SAS1R was hypothesized herein to be a candidate contraceptive vaccinogen and immunogen. Immunogenicity of recombinant mouse SAS1R was tested in female mice ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
pHaaaaaaaaaa
mole fractionaaaaaaaaaa
mole fractionaaaaaaaaaa
Login to View More

Abstract

The present invention provides compositions and methods useful for regulating fertilization and for use as a contraceptive based on the discovery herein of an oocyte specific protein, SAS1R (Sperm Acrosomal SLLP1 Receptor), which is a sperm protein receptor. Six SAS1R variants, including the full length SAS1R, were identified. mSLLP1 and SAS1R co-localized to oocytes and to acrosomes of acrosome-reacted sperm. Interactions between mSLLP1 and SAS1R were demonstrated by far-western analysis, in a yeast two-hybrid system under stringent selection conditions, and by immunoprecipitation of SAS1R by anti-mSLLP1 as well as the converse. Purified recombinant SAS1R was found to have protease activity, to inhibit fertilization in-vitro, and to induce an immune response in females. Together, the results suggest SAS1R is a proteolytically active, oocyte and early embryo specific oolemmal metalloprotease receptor for the sperm intra-acrosomal ligand SLLP1 and is a target for regulating fertilization and as a contraceptive.

Description

CROSS REFERENCE TO RELATED APPLICATIONS[0001]This application is a continuation-in-part of U.S. patent application Ser. No. 11 / 915,225, filed Nov. 24, 2008, which claims the benefit of priority to International Application No. PCT / US2006 / 005970, filed on Feb. 21, 2006, which is entitled to priority pursuant to 35 U.S.C. ยง119(e) to U.S. Provisional Patent Application Serial Nos. 60 / 655,562, filed Feb. 23, 2005, and 60 / 689,181, filed Jun. 10, 2005, and this application is further entitled priority to U.S. Provisional Patent Application Ser. No. 61 / 111,903, filed Nov. 6, 2008, 61 / 225,790, filed Jul. 15, 2009, 61 / 243,411 filed Sep. 17, 2009, and 61 / 244,543, filed Sep. 22, 2009, the entire disclosures of which are herein incorporated by reference.STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT[0002]This invention was made in part with United States Government support under Grant Nos. R03 HD0551 awarded by the NH and D43 TW / HD 00654 from the Fogarty International Center. T...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(United States)
IPC IPC(8): A61K39/395G01N33/567C07K16/18A61K39/00A61K38/46
CPCA61K38/177A61K38/4886A61K39/0006C07K16/28C07K2317/76G01N2333/96486G01N2500/04A61K38/1709C07K2316/96
InventorHERR, JOHN C.SACHDEV, MONIKAMANDAL, ARABINDA
OwnerUNIV OF VIRGINIA ALUMNI PATENTS FOUND