Acyl carrier protein III epitope, acyl carrier protein III antibody and use thereof
An acyl carrier protein, antigen epitope technology, applied in the fields of molecular biology and immunology, can solve the problem of not being able to trigger an immune response, and achieve the effects of easy spatial conformation reproduction, high specificity, and short fragments
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0044] Example 1: Prediction of Candidate Epitopes
[0045] The gene ID of the gene corresponding to rice acyl carrier protein Ⅲ in GenBank is: NP_001051948.1. The reading frame sequence is as follows:
[0046] ATGGCTGCTCCCATCACCGCCGCCACATCGCCTCTCTCCCCTGCGTCTCGGGTTCAGGTGATGTGCTCAATGCTCAATCCAACCTCAGCTTCTTTCTCCAGGCAAACAGCAAGCTTCCCGTCCATTCGGTTGCGCCCGGTCCCAAGTCGCTTCCAGGCCTTGTCTTGTTCGGCCAAACAAGACACTATTGATAAGGTTTGCGAAATAGTTAAGAATCAGTTAGCAGTAGATGAAGGCACTGCCGTTTCTGGAGAAACAAAATTCGTGGACCTTGGTGCTGATTCACTTGACACGGTTGAAATTGTGATGGGCCTTGAGGAGGCATTTCAGATTACCGTGGACGAATCGAGTGCGCAAGTGATTCAGACAGTGGAGGATGCTGCTGTGCTTATCGACAAGCTTGTGGCAGAGAAGGACGCCTAA(SEQ ID NO:1)
[0047] The full-length sequence of the encoded rice acyl carrier protein III is as follows:
[0048] MAAPITAATSPLSPASRVQVMCSMLNPTSASFSRQTASFPSIRLRPVPS TIDKVCEIVKNQLAVDEGTAVSGETKFVDLGADSLDTVEIVMGLEEAFQITVDESSAQVIQTVEDAAVLIDKLVAEKDA
[0049] (SEQ ID NO: 2, wherein the framed sequence is SEQ ID NO: 3)
[0050] Then, according to SEQ ID...
Embodiment 2
[0053] Example 2: Chemical Synthesis of Antigenic Epitopes
[0054] There is no cysteine at both ends of the candidate antigen epitope obtained in Example 1. In order to realize the cross-linking with the carrier, the synthesized sequence needs to add cysteine, so the polypeptide sequence to be synthesized is: CRFQALSCSAKQD (SEQ ID NO :5).
[0055] The polypeptide sequence shown in SEQ ID NO: 5 was chemically synthesized (synthesized by Jill Biochemical Company) to obtain the antigenic epitope of acyl carrier protein III.
Embodiment 3
[0056] Embodiment 3: the preparation of epitope-KLH complex
[0057] Using the glutaraldehyde linkage method, the N-terminal of the epitope synthesized in Example 2 was cross-linked with the cross-linking carrier protein-keyhole limpet hemocyanin (KLH) to obtain the epitope-KLH complex.
[0058] The specific implementation steps are as follows:
[0059] Add 5 mg of synthetic peptide to 7 mg of KLH, slowly add 1 ml of freshly prepared 3 g / L glutaraldehyde solution while shaking, and incubate at room temperature for 2 h. The epitope-KLH complex was obtained by dialysis with pH 8.5 boric acid buffer for 24 hours.
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap