In-vitro embryo culture solution containing Clusterin protein and application of in-vitro embryo culture solution in embryo cryopreservation
A technology of embryo culture medium and embryos, which is applied to the preservation and application of human or animal bodies, embryo cells, etc., and can solve the problems of antifreeze toxicity, decreased birth rate of fresh embryos, and inability to protect cells, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment
[0044] 1 material
[0045] 1.1 Main instruments and equipment
[0046]
[0047] 1.2 Main reagents
[0048] 1.2.1 Recombinant Clusterin protein derived from mouse in vitro was purchased from Abcam (Product No.: ab194035), and its amino acid sequence is as follows:
[0049] EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAEVDHHHHHH
[0050] 1.2.2 CZB medium
[0051] (1) CZB stock solution 100mL formula
[0052]
[0053] Preparation method: Mix liquid A and liquid B, and then dilute to 100mL with high-pressure ultra-pure water.
[0054] (2) CZB working solution 5mL formula
[0055]
[0056]
...
PUM
| Property | Measurement | Unit |
|---|---|---|
| concentration | aaaaa | aaaaa |
| concentration | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



