A kind of polypeptide and its application

A technology of peptides and amino acids, applied in the biological field, to achieve the effect of lowering blood sugar, improving the function of pancreatic islets, and wide application prospects

Active Publication Date: 2020-11-17
INST OF PROCESS ENG CHINESE ACAD OF SCI
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, such vaccines have not been reported

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of polypeptide and its application
  • A kind of polypeptide and its application
  • A kind of polypeptide and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0040] Embodiment 1 The preparation of epitope polypeptide of the present invention and its vaccine

[0041] The epitope polypeptide of the present invention is obtained by analyzing the epitope sequence of the IL-1β protein. The amino acid sequence of the polypeptide is: SEQ ID NO.1: VQGEESNDKESVDPKNYPKKKMEKRFVFNKIEINNKLEF, and the polypeptide is fully synthesized and purified.

[0042] Vaccine (Al adjuvant) group: After the epitope polypeptide is dissolved in PBS, it is blown and mixed with the aluminum adjuvant for injection at a volume ratio of 3:1. Vaccine (PLA microsphere adjuvant) group: Mix 5 mg / mL PLA with epitope polypeptide, suspend overnight at 4°C. Adjuvant control group: PBS solution and adjuvant were mixed by pipetting at a volume ratio of 3:1. Get the vaccine.

experiment example 2

[0043] Experimental Example 2 Effect of IL-1β Epitope Vaccine on Mouse Antibody Titer

[0044] Mice were injected subcutaneously on days 0, 14, and 28 at biweekly intervals. Each mouse in the vaccine group was injected with a vaccine containing 50 μg of epitope polypeptide. Adjuvant control group and C57 control group were injected with an equal volume of adjuvant solution without epitope polypeptide.

[0045] Determination of antibody titer: Blood was collected from the tail vein on the 10th, 24th and 38th day after the first immunization, and the blood was left to stand at 37°C for 2 hours, centrifuged at 4000r / min for 5min, and the upper serum was taken and packed for use .

[0046] 100 μL of epitope peptides were coated with 0.5 μg / well of 96-well ELISA microplate, BSA was used as negative control, placed at 37°C for 2 hours, blocked with 5% BSA at 37°C for 2 hours, 340 μL / well. The plate was washed 3 times with PBS, 100 μL of mouse serum serially diluted with 5% BSA wa...

experiment example 3

[0048] Experimental example 3 IL-1β epitope vaccine to KK-A y Effects on blood glucose levels in mice

[0049] Blood glucose measurement: The fasting blood glucose of the mice was measured with a Roche blood glucose meter / vigor type on days 0, 14, 28, and 42 after the first immunization at biweekly intervals.

[0050] The blood glucose levels of mice in each group were as follows: Figure 2(A) and 2(B) As shown, the average fasting blood glucose of the C57 control group on days 0, 14, 28, and 42 were 4.0, 4.4, 4.6, and 4.7 respectively; the average fasting blood glucose of the adjuvant control group on days 0, 14, 28, and 42 were 4.3, 11.0, 12.3, 13.0; the average fasting blood glucose of the vaccine group (Al) on days 0, 14, 28, and 42 were 4.3, 9.7, 8.7, 8.5; the vaccine group (PLA) on days 0, 14, 28, The average fasting blood sugar in 42 days was 4.3, 8.1, 8.8, 9.1 respectively; the experimental results showed that KK-A y The blood glucose level of mice increases rapidly...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
thicknessaaaaaaaaaa
Login to View More

Abstract

The invention relates to polypeptide, a polypeptide vaccine and application thereof. An amino acid sequence of the polypeptide is an amino acid sequence shown as SEQ ID NO.1. The polypeptide and the vaccine which are disclosed by the invention not only keep immunogenicity of a full-length IL-1beta protein, but also avoid or reduce acute toxicity possibly caused by the full-length IL-1beta protein to the greatest degree, have a small side effect, and have wide application prospect in the aspect of disease treatment related to inflammation of type II dibetes and the like.

Description

technical field [0001] The invention relates to the field of biotechnology, in particular to a polypeptide, a polypeptide vaccine and applications thereof. Background technique [0002] Diabetes mellitus is a chronic disease of carbohydrate, fat and protein metabolism disorder caused by relative or absolute deficiency of insulin in the body, or decreased sensitivity of target cells to insulin, or structural defects in insulin itself. According to the latest data released by the World Health Organization, diabetes has become the third largest disease after cardiovascular and cerebrovascular diseases and malignant tumors. There are currently 366 million people with diabetes in the world, and it is estimated that this number will reach 552 million by 2030, among which type 2 diabetes (T2DM) accounts for more than 90% of the total number of patients. my country has become the world's largest diabetes country, with a prevalence rate of 9.7% and 92 million people, which is higher...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityPatents(China)
IPC IPC(8): C07K14/545C12N15/25C12N15/63A61P3/10C12Q1/6876G01N33/68
CPCC07K14/545C12Q1/6883C12Q2600/158G01N33/6869G01N2800/042
Inventor刘瑞田于晓琳查君
OwnerINST OF PROCESS ENG CHINESE ACAD OF SCI