Unlock instant, AI-driven research and patent intelligence for your innovation.

Tag polypeptide for promoting protein soluble expression and use thereof

A protein and soluble technology, applied in the field of genetic engineering, to achieve high-efficiency production and low-cost effects

Active Publication Date: 2021-08-27
INSITUTE OF BIOPHYSICS CHINESE ACADEMY OF SCIENCES
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0007] In order to solve the above-mentioned defects existing in the prior art, the object of the present invention is to provide a short peptide to replace GST / MBP, which can promote protein soluble expression and avoid GST / MBP due to excessive molecular weight. Insufficient, and low-cost, simple and efficient production of peptides

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Tag polypeptide for promoting protein soluble expression and use thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0043] Example 1 Soluble Expression of Mouse Resistin Protein

[0044] The mouse resistin protein (RESISTIN) sequence contains 114 amino acid residues, and the initial 20 amino acid sequence is a signal peptide that guides the protein to translocate across the cell membrane. The signal peptide is usually removed during recombinant expression, and the rest is shown in SEQ ID NO.:3 94 amino acid residues, its specific amino acid sequence is as follows:

[0045] SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGT AVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS).

[0046] The corresponding nucleotide sequence is shown in SEQ ID NO.:4, a total of 282 base pairs, and its specific nucleotide sequence is as follows:

[0047] TCCAGCATGCCACTGTGTCCCATCGATGAAGCCATCGACAAGAAGATC AAACAAGACTTCAACTCCCTGTTTCCAAATGCAATAAAGAACATTGGC TTAAATTGCTGGACAGTCTCCTCCAGAGGGAAGTTGGCCTCCTGCCCA GAAGGCACAGCAGTCTTGAGCTGCTCCTGTGGCTCTGCCTGTGGCTCG TGGGACATTCGTGAAGAAAAAGTGTGTCACTGCCAGTGTGCAAGGAT AGACTGGACAGCAGCCCGCTGCT...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a tag polypeptide for promoting protein soluble expression and its application. Wherein, the tag polypeptide has an amino acid sequence selected from the following: 1) the amino acid sequence shown in SEQ ID NO.: 1; 2) the amino acid sequence shown in SEQ ID NO.: 1 is substituted, deleted or added with one or more amino acids The resulting amino acid sequence; or 3) an amino acid sequence having more than 90% sequence identity with SEQ ID NO.:1. Utilizing the tag polypeptide of the present invention can improve the soluble expression of the target protein, avoid the unfavorable factors of immune interference and protease cleavage cumbersome operation caused by exogenous fusion proteins (such as GST, MBP), and can produce the target protein at low cost, simply and efficiently.

Description

technical field [0001] The invention belongs to the field of genetic engineering. More specifically, the present invention relates to tag polypeptides that promote soluble expression of proteins and uses thereof. Background technique [0002] Protein is the research object and material of many researches in biomedicine, and it is also an important product of our medical industry. For example, insulin and interferon are proteins, so the expression and production of protein is an important link in our scientific research and social industry. [0003] Extracting target proteins from primitive organisms, such as extracting insulin from porcine pancreas, is expensive and cannot be popularized. Nucleotide recombination technology in modern molecular biology can recombine and express target proteins at low cost and on a large scale, which is a great technological breakthrough in the past half century. However, high-level and rapid expression of recombinant proteins will lead to i...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K7/08C07K14/00C07K19/00C12N15/11C12N15/62C12N15/70C12N1/21C12R1/19
CPCC07K7/08C07K14/00C07K14/575C07K2319/35C12N15/70
Inventor 欧先金李雪梅
Owner INSITUTE OF BIOPHYSICS CHINESE ACADEMY OF SCIENCES
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com