P97 fusion proteins

a technology of fusion proteins and p97, which is applied in the direction of transferrins, antibody medical ingredients, drug compositions, etc., can solve the problems of poor tissue penetration, insufficient amount of effective diagnosis and therapy, and insufficient cross-bbb effect of diagnosis and therapy

Inactive Publication Date: 2016-12-01
BIOASIS TECH
View PDF14 Cites 9 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The present invention provides p97-trastuzumab fusion proteins that combine the heavy chain and / or light chain sequences of trastuzumab with the p97 sequence. These fusion proteins have improved pharmacokinetics and can be used to treat cancer. The invention also includes isolated polynucleotides and vectors that encode the p97 fusion proteins, as well as recombinant host cells that produce them. The technical effects of the invention include improved tumor targeting, reduced systemic toxicity, and improved efficacy of cancer treatment.

Problems solved by technology

Overcoming the difficulties of delivering therapeutic or diagnostic agents to specific regions of the brain represents a major challenge to treatment or diagnosis of many central nervous system (CNS) disorders, including those of the brain.
Therapeutic molecules and genes that might otherwise be effective in diagnosis and therapy do not cross the BBB in adequate amounts and often have poor tissue penetration, even in peripheral tissues.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • P97 fusion proteins
  • P97 fusion proteins
  • P97 fusion proteins

Examples

Experimental program
Comparison scheme
Effect test

example 1

Binding of p97-Trastuzumab Fusion Proteins to Human Her2 / Neu

[0239]Human p97 (MTf)-trastuzumab fusion constructs were prepared and tested for activity. The amino acid sequences of the MTf-trastuzumab fusion constructs are shown in Table E1 below.

TABLE E1SEQ IDNameHeavy and Light Chain SequencesNOTZM HC-MTfHeavy Chain82HomodimerSignal sequence (italics): TZM heavy chain: linker(C-terminal(underlined): MTf (bold)TZM heavyMETDTLLLWVLLLWVPGSTGEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTchain MTf;YIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSee FIG.SLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSK1A forSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVgeneralVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGstructure)PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSGGGGSGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSLight Chain83S...

example 2

ADCC Cell-Killing Activity of p97-Trastuzumab Fusion Proteins

[0243]MTf-trastuzumab fusion constructs were tested for Antibody-dependent cell-mediated cytotoxicity (ADCC) in BT-474 breast cancer cells compared to Herceptin® (trastuzumab) and human IgG1 Fc as positive and negative controls, respectively.

[0244]BT-474 cells were purchased from ATCC and grown in Hybri-Care Medium supplemented with 1.5 g / L sodium bicarbonate and 10% fetal bovine serum. Human peripheral blood mononuclear cells (PBMCs) were freshly isolated by Histopaque centrifugation and incubated with carboxyfluorescein succinimidyl ester (CFSE)-labeled target BT-474 cells at a ratio of about 30:1.

[0245]Test samples were co-incubated with the effector:target cell mixture for four hours at ten different concentrations (up to 100 μg / mL). Negative controls included effector:target cells only as no antibody control, and 100 μg / mL IgG Fc. Each treatment was performed in duplicate. After the 4 hour co-incubation, cells were st...

example 3

In Vivo Anti-Tumor Efficacy of p97-Trastuzumab Fusion Proteins

[0248]The p97-trastuzumab fusion proteins are tested for anti-tumor efficacy and effects on survival in mice that are intracranially injected with human BT-474 breast tumor cells. Specifically, the fusion constructs TZM HC-MTf and MTfp NH-TZM are tested relative to Herceptin® (Trastuzumab, AMM: 5621037, ROCHE).

[0249]Test Compounds.

[0250]The stock solutions of TZM HC-MTf and MTfp NH-TZM constructs are diluted in PBS and administered respectively at 60 mg / kg and 30 mg / kg (equivalent dose of 30 mg / kg Herceptin®). Herceptin® is prepared as follows: one vial containing 150 mg of Herceptin® is diluted in NaCl 0.9% (Aguettant, Lyon, France) to a final concentration of 20 mg / mL. The stock solution is stored at 4° C. for the duration of the study. Each day of administration to mice, the stock solution is diluted in NaCl 0.9% to reach 3 mg / mL final concentration. Herceptin® is administrated at 30 mg / kg.

[0251]All compounds are admin...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
Fractionaaaaaaaaaa
Lightaaaaaaaaaa
Login to View More

Abstract

Provided are p97 (melanotransferrin)-trastuzumab fusion proteins and related methods of use thereof, for instance, to facilitate delivery of trastuzumab across the blood-brain barrier (BBB) and / or improve tissue penetration of the antibody in CNS and peripheral tissues, and thereby treat and / or diagnose HER2-positive cancers, including those of the central nervous system (CNS).

Description

CROSS-REFERENCE TO RELATED APPLICATIONS[0001]This application claims priority under 35 U.S.C. §119(e) to U.S. Application No. 61 / 935,253, filed Feb. 3, 2014, which is incorporated by reference in its entirety.SEQUENCE LISTING[0002]The Sequence Listing associated with this application is provided in text format in lieu of a paper copy, and is hereby incorporated by reference into the specification. The name of the text file containing the Sequence Listing is BIOA_008_01 WO_ST25.txt. The text file is about 340 KB, was created on Feb. 3, 2015, and is being submitted electronically via EFS-Web.BACKGROUND[0003]Technical Field[0004]Embodiments of the present invention relate to p97 (melanotransferrin)-trastuzumab fusion proteins and antibody fusion proteins and related methods of use thereof, for instance, to facilitate delivery of trastuzumab across the blood-brain barrier (BBB) and / or improve tissue penetration of the antibody in CNS and peripheral tissues, and thereby treat and / or diag...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/79A61K39/395C07K16/32
CPCC07K14/79C07K16/32A61K39/39558A61K2039/505C07K2317/732C07K2319/10C07K2319/74C07K2317/515A61P1/00A61P15/00A61P35/00A61P35/04C07K2319/00
InventorVITALIS, TIMOTHY Z.GABATHULER, REINHARD
OwnerBIOASIS TECH