Methods and compositions for treating myelofibrosis

a technology of compositions and myelofibrosis, applied in the field of methods and compositions for treating myelofibrosis, can solve the problems of unmet needs for effective therapies, high treatment-related mortality, and many other currently available treatments that are not effective in reversing the process of myelofibrosis, and achieve the effects of reducing splenomegaly, fibrosis, and extramedullary hematopoiesis

Inactive Publication Date: 2018-02-22
ACCELERON PHARMA INC
View PDF5 Cites 15 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The patent describes methods for treating myelofibrosis, a disease that causes fatigue and damage to organs, by using a combination of a Janus kinase inhibitor and an ActRIIB antagonist. The goal is to slow down the progression of the disease and reduce symptoms in patients with myelofibrosis. The methods may also include additional therapies such as blood transfusions, iron chelators, corticosteroids, and other drugs. The patent also introduces the concept of a synergistic effect, which refers to the combination of two drugs that work together to create a more powerful effect than either drug alone. The Janus kinase inhibitor and ActRIIB antagonist can be used in different ways, either before or after each other, or at the same time. The patent provides a list of specific drugs that can be used for this purpose, including ruxolitinib. Overall, the patent offers a potential new treatment strategy for myelofibrosis that targets the underlying cause of the disease.

Problems solved by technology

However, treatment-related mortality is high, and only a minority of patients qualify for transplantation.
Many of other currently available treatments are not effective in reversing the process of myelofibrosis, be it primary or secondary disease.
Thus, there is a high, unmet need for effective therapies for treating myelofibrosis.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Methods and compositions for treating myelofibrosis
  • Methods and compositions for treating myelofibrosis
  • Methods and compositions for treating myelofibrosis

Examples

Experimental program
Comparison scheme
Effect test

example 1

n of ActRIIB-Fc Fusion Proteins

[0275]Applicants constructed a soluble ActRIIB fusion protein that has the extracellular domain of human ActRIIB fused to a human or mouse Fc domain with a minimal linker (three glycine amino acids) in between. The constructs are referred to as ActRIIB-hFc and ActRIIB-Fc, respectively.

[0276]ActRIIB-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 24):

GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDENCYDRQECVATEENPQVYFCCCEGNECNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPSVFLEPPKPKDTLMIS

[0277]The ActRIIB-hFc and ActRIIB-Fc proteins were expressed in CHO cell lines. Three different leader sequences were considered: (i) Honey bee mellitin (HBML):

(SEQ ID NO: 21)MKFLVNVALVFMVVYISYIYA,

ii) Tissue plasminogen activator (TPA):

(SEQ ID NO: 22)MDAMKRGLCCVLLLCGAVFVSP,

and (iii) Native:

(SEQ ID NO: 23)MGAAAKLAFAVFLISCSSGA.

[0278]The selected form employs the TPA leader and has the following unprocessed amino acid sequence (SEQ ID NO: 25):

MDAMK...

example 2

n of a GDF Trap

[0292]Applicants constructed a GDF trap as follows. A polypeptide having a modified extracellular domain of ActRIIB (amino acids 20-134 of SEQ ID NO: 1 with an L79D substitution) with greatly reduced activin A binding relative to GDF11 and / or myostatin (as a consequence of a leucine-to-aspartate substitution at position 79 in SEQ ID NO:1) was fused to a human or mouse Fc domain with a minimal linker (three glycine amino acids) in between. The constructs are referred to as ActRIIB(L79D 20-134)-hFc and ActRIIB(L79D 20-134)-Fc, respectively. Alternative forms with a glutamate rather than an aspartate at position 79 performed similarly (L79E). Alternative forms with an alanine rather than a valine at position 226 with respect to SEQ ID NO: 44, below were also generated and performed equivalently in all respects tested. The aspartate at position 79 (relative to SEQ ID NO: 1, or position 60 relative to SEQ ID NO: 29) is indicated with double underlining below. The valine at...

example 3

for GDF-11- and Activin-Mediated Signaling

[0300]An A-204 reporter gene assay was used to evaluate the effects of ActRIIB-Fc proteins and GDF traps on signaling by GDF-11 and activin A. Cell line: human rhabdomyosarcoma (derived from muscle). Reporter vector: pGL3(CAGA)12 (described in Dennler et al, 1998, EMBO 17: 3091-3100). The CAGA12 motif is present in TGF-beta responsive genes (e.g., PAI-1 gene), so this vector is of general use for factors signaling through SMAD2 and 3.

[0301]Day 1: Split A-204 cells into 48-well plate.

[0302]Day 2: A-204 cells transfected with 10 ug pGL3(CAGA)12 or pGL3(CAGA)12(10 ug)+pRLCMV (1 μg) and Fugene.

[0303]Day 3: Add factors (diluted into medium+0.1% BSA). Inhibitors need to be preincubated with factors for 1 hr before adding to cells. Six hrs later, cells were rinsed with PBS and lysed.

[0304]This is followed by a luciferase assay. In the absence of any inhibitors, activin A showed 10-fold stimulation of reporter gene expression and an ED50˜2 ng / ml. GD...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
Fractionaaaaaaaaaa
Fractionaaaaaaaaaa
Fractionaaaaaaaaaa
Login to View More

Abstract

In part, the present disclosure relates methods for treating, preventing, or reducing the progression rate and / or severity of myelofibrosis or one or more complications of myelofibrosis (extramedullary hematopoiesis, splenomegaly, anemia, and fibrosis). In certain aspects, the disclosure provides ActRIIB antagonists for use in treating, preventing, or reducing the progression rate and / or severity of one or more complications associated with Janus kinase inhibitor therapy in a patient (e.g., anemia).

Description

CROSS-REFERENCE TO RELATED APPLICATIONS[0001]This application claims the benefit of priority to U.S. provisional application Ser. No. 62 / 367,289, filed on Jul. 27, 2016. The disclosure of the foregoing application is hereby incorporated by reference in its entirety.BACKGROUND OF THE INVENTION[0002]Myelofibrosis is a rare disease mainly affecting people of older age. Myelofibrosis is a BCR-ABL1-negative myeloproliferative neoplasm that presents de novo (primary) or may be preceded by polycythemia vera (post-polycythemia vera) or essential thrombocythemia (post-essential thrombocythemia). Clinical features include progressive anemia, marked splenomegaly, fibrosis (e.g., bone marrow fibrosis), constitutional symptoms (e.g., fatigue, night sweats, bone pain, pruritus, and cough), and weight loss [Tefferi A (2000) N Engl J Med 342:1255-1265]. Median survival ranges from less than 2 years to over 15 years based on currently identified prognostic factors. Mutations involving JAK2, MPL, TET...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A61K38/17A61K31/519
CPCA61K38/179A61K31/519C07K2319/30A61P7/06A61P7/00C07K14/71A61K38/1796A61K45/06A61K2300/00A61K31/155A61K38/17A61K39/3955A61K2039/505
InventorKUMAR, RAVINDRAVENKATA SAI RAJASEKHAR SURAGANI, NAGA
OwnerACCELERON PHARMA INC