Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide

A composition and drug technology, applied in the field of active peptides, can solve the problems of cumbersome purification methods and achieve the effects of simple separation methods, strong analgesic effect and low toxicity

Inactive Publication Date: 2014-07-16
曹征宇
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Recently, Chinese patent 01128235.5 reported a scorpion analgesic anti-tumor valerin and its obtaining method, but its purification method is cumbersome

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide
  • Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide
  • Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0023] The following examples are used to further illustrate the present invention, but this does not imply any limitation to the present invention. Embodiment 1 Active peptide separation and purification of the present invention

[0024] The crude venom of East Asian scorpion was dissolved in distilled water (1 g was dissolved in 30 ml distilled water), centrifuged at 10000 r / min for 10 minutes, the precipitate was discarded, and the supernatant was freeze-dried. Redissolve 500 mg of the lyophilized supernatant in 10 ml of water, separate with Sephadex G-50, elute with water, the column length (2.6×100 cm), collect the analgesic component (about 350 mg), and lyophilize the analgesic component Dissolve in 0.01mol / L PBS (pH6.8), load the sample on the pre-equilibrated CM-Sephadex C-50 ion exchange column (2.6×50cm), first elute with the equilibrium buffer until no protein peak appears, and then Elute with 0.02mol / L NaCL+0.01mol / L PBS. The eluate was collected, dialyzed, and f...

experiment example 1

[0038] The analgesic activity of experimental example 1 active peptide of the present invention is measured

[0039] The analgesic activity was measured using the mouse acetic acid writhing model. 0.9% NaCl was used as the blank control, and morphine was used as the positive control. The mice were randomly divided into 6 groups, 10 in each group, and the active peptide of the present invention and the blank control (0.9% NaCl ) and positive control (0.2mg / kg morphine).

[0040] The result is as follows:

[0041]

[0042]

[0043] Note, *p<0.05, **P<0.01, ***P<0.001, compared with the control group.

experiment example 2

[0044] Experimental example 2: Toxicity determination of East Asian scorpion with low toxicity and analgesic active peptide

[0045] The active peptide of the present invention was dissolved in 0.9% NaCl solution, and the mice were randomly divided into 6 groups, two in each group, with different doses (1mg / kg, 5mg / kg, 10mg / kg, 20mg / kg, 50mg / kg) Active peptide of the present invention and blank control (0.9% NaCL) were injected intravenously. It was found that under the dose of <20mg / kg, no toxic reaction was observed, only in the 50mg / kg dose group, the mice had a toxic reaction in 5 minutes, but recovered in 10 minutes. It shows that the toxicity of the active peptide of the present invention is very low.

[0046] Preparation of the pharmaceutical composition:

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses novel peptide extracted from Buthus martensii kirsch, and the amino acid sequence of the peptide is VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVPGKCQ. The invention further provides a preparation method of the novel peptide, a pharmaceutical composition comprising the novel peptide, and the application of the novel peptide in preparation of analgesics. The peptide has the advantages of being high in analgesic activity and low in toxicity, the content of the peptide in the Buthus martensii kirsch is high, and the separation and purge process is simple.

Description

technical field [0001] The present invention relates to the active peptide extracted from the East Asian scorpion scorpion, its preparation method, its pharmaceutical composition, and its use as an analgesic drug. The amino acid sequence of this peptide is VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVP GKCQ. Background technique [0002] East Asian scorpion is the most widely distributed scorpion species in China, and it has been used as medicine for more than a thousand years. It has the effects of calming wind and spasm, attacking poison and dispelling stagnation, dredging collaterals, and relieving pain. Traditional Chinese medicine is used to treat convulsions in children, convulsions, convulsions, crooked mouth and eyes due to stroke, hemiplegia, tetanus, rheumatism intractable numbness, migraine headaches, sores, and scrofula. [0003] Modern studies have shown that the pharmacological activity of the scorpion tail is 4-5 times stronger than that of the...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/435C07K1/18C07K1/20A61K38/17A61P29/00
CPCC07K14/43522A61K38/00
Inventor 曹征宇张剑
Owner 曹征宇
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com