Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide

A composition and drug technology, applied in the field of active peptides, can solve the problems of cumbersome purification methods and achieve the effects of simple separation methods, strong analgesic effect and low toxicity

Inactive Publication Date: 2014-07-16
曹征宇
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Recently, Chinese patent 01128235.5 reported a scorpion analgesic anti-tumor

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide
  • Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide
  • Novel peptide, preparation method thereof, pharmaceutical composition comprising novel peptide and application of novel peptide

Examples

Experimental program
Comparison scheme
Effect test

Example Embodiment

[0023] The following examples are used to further illustrate the present invention, but this is not meant to limit the present invention. Example 1 Separation and purification of active peptides of the present invention

[0024] The crude scorpion venom was dissolved in distilled water (1g dissolved in 30ml distilled water), centrifuged at 10000r / min for 10 minutes, the precipitate was discarded, and the supernatant was freeze-dried. Re-dissolve 500mg of the lyophilized supernatant in 10ml of water, separate with Sephadex G-50, eluting with water, column length (2.6×100cm), collect the analgesic component (about 350mg), and freeze-dry the analgesic component Then dissolve in 0.01mol / L PBS (pH 6.8), load the sample on a pre-equilibrated CM-Sephadex C-50 ion exchange column (2.6×50cm), eluted with equilibration buffer until no protein peak appears, and then Eluted with 0.02mol / L NaCL+0.01mol / L PBS. The eluate was collected, dialyzed, and lyophilized. The lyophilized powder was d...

Example Embodiment

[0038] Experimental Example 1 Determination of analgesic activity of the active peptide of the present invention

[0039] The analgesic activity was measured using a mouse acetic acid writhing model. 0.9% NaCl was used as a blank control, and morphine was used as a positive control. The mice were randomly divided into 6 groups, each with 10 mice. The active peptide of the present invention and a blank control (0.9% NaCl) were injected intravenously at different doses (0.1 mg / kg, 0.2 mg / kg, 0.4 mg / kg, 0.8 mg / kg). ) And positive control (0.2mg / kg morphine).

[0040] The results are as follows:

[0041]

[0042]

[0043] Note, *p <0.05, **P <0.01,***P <0.001, compared with the control group.

Example Embodiment

[0044] Experimental example 2: East Asia pincers low toxicity, toxicity determination of analgesic peptide

[0045] The active peptide of the present invention was dissolved in 0.9% NaCl solution, the mice were randomly divided into 6 groups, two in each group, with different doses (1mg / kg, 5mg / kg, 10mg / kg, 20mg / kg, 50mg / kg) The active peptide of the present invention and a blank control (0.9% NaCL) were injected intravenously. It turns out that At a dose of <20 mg / kg, no toxicity was observed. Only in the 50 mg / kg dose group, the mice had a toxic reaction at 5 minutes, but recovered at 10 minutes. It shows that the toxicity of the active peptide of the present invention is very low.

[0046] Preparation of pharmaceutical composition:

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses novel peptide extracted from Buthus martensii kirsch, and the amino acid sequence of the peptide is VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVPGKCQ. The invention further provides a preparation method of the novel peptide, a pharmaceutical composition comprising the novel peptide, and the application of the novel peptide in preparation of analgesics. The peptide has the advantages of being high in analgesic activity and low in toxicity, the content of the peptide in the Buthus martensii kirsch is high, and the separation and purge process is simple.

Description

technical field [0001] The present invention relates to the active peptide extracted from the East Asian scorpion scorpion, its preparation method, its pharmaceutical composition, and its use as an analgesic drug. The amino acid sequence of this peptide is VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVP GKCQ. Background technique [0002] East Asian scorpion is the most widely distributed scorpion species in China, and it has been used as medicine for more than a thousand years. It has the effects of calming wind and spasm, attacking poison and dispelling stagnation, dredging collaterals, and relieving pain. Traditional Chinese medicine is used to treat convulsions in children, convulsions, convulsions, crooked mouth and eyes due to stroke, hemiplegia, tetanus, rheumatism intractable numbness, migraine headaches, sores, and scrofula. [0003] Modern studies have shown that the pharmacological activity of the scorpion tail is 4-5 times stronger than that of the...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
IPC IPC(8): C07K14/435C07K1/18C07K1/20A61K38/17A61P29/00
CPCC07K14/43522A61K38/00
Inventor 曹征宇张剑
Owner 曹征宇
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap