Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Wheat low temperature resistance regulating agent and using method thereof

A regulator, anti-low temperature technology, applied in the directions of plant growth regulators, plant growth regulators, botanical equipment and methods, etc., can solve problems such as unsatisfactory effects, achieve good health, easy degradation, and improve comprehensive resistance. force effect

Inactive Publication Date: 2017-09-22
兰溪市酉泽饲料技术服务有限公司
View PDF8 Cites 7 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The wheat low temperature resistance and lodging resistance increase yield regulator has the characteristics of improving the cold resistance and lodging resistance of wheat, but the effect is not ideal

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0014] Wheat anti-low temperature regulator, the ingredients and parts by weight are: 22 parts of betaine, 12 parts of chitosan oligosaccharide, 8 parts of salicylic acid, 10 parts of potassium silicate, 5 parts of surfactant, 0.2 part of protein polypeptide, 2 parts of dispersant 24 parts of water. The surfactant is one or two mixtures of Tween series and / or Span series; the amino acid sequence of the protein peptide is HSHACVCVNCFCCGAAKCYLCRVLHPGKLCVCNCSK, and the protein peptide can be directly converted into amino acids by microorganisms to accelerate the proliferation of microorganisms. A large number of microorganisms will secrete metabolites such as microbial polysaccharides and organic acids, which can improve soil water and fertilizer retention, aeration, and the ability to regulate heat and cold; the dispersant is alkyl naphthalene sulfonate and polycarboxylate, and the weight ratio is 1: 1.

[0015] The preparation method of wheat anti-low temperature regulator is:...

Embodiment 2

[0020] Wheat anti-low temperature regulator, the ingredients and parts by weight are: 30 parts of betaine, 10 parts of chitosan oligosaccharide, 6 parts of salicylic acid, 8 parts of potassium silicate, 6 parts of surfactant, 0.4 part of protein polypeptide, 2 parts of dispersant 24 parts of water. The surfactant is one or two mixtures of Tween series and / or Span series; the amino acid sequence of the protein peptide is HSHACVCVNCFCCGAAKCYLCRVLHPGKLCVCNCSK, and the protein peptide can be directly converted into amino acids by microorganisms to accelerate the proliferation of microorganisms. A large number of microorganisms will secrete metabolites such as microbial polysaccharides and organic acids, which can improve soil water and fertilizer retention, aeration, and the ability to regulate heat and cold; the dispersant is alkyl naphthalene sulfonate and polycarboxylate, and the weight ratio is 1: 1.5.

[0021] The preparation method of wheat anti-low temperature regulator is...

Embodiment 3

[0026] Wheat anti-low temperature regulator, the ingredients and parts by weight are: 25 parts of betaine, 12 parts of chitosan oligosaccharide, 8 parts of salicylic acid, 12 parts of potassium silicate, 6 parts of surfactant, 0.3 part of protein polypeptide, 4 parts of dispersant part, 25 parts of water. The surfactant is one or two mixtures of Tween series and / or Span series; the amino acid sequence of the protein peptide is HSHACVCVNCFCCGAAKCYLCRVLHPGKLCVCNCSK, and the protein peptide can be directly converted into amino acids by microorganisms to accelerate the proliferation of microorganisms. A large number of microorganisms will secrete metabolites such as microbial polysaccharides and organic acids, which can improve soil water and fertilizer retention, aeration, and the ability to regulate heat and cold; the dispersant is alkyl naphthalene sulfonate and polycarboxylate, and the weight ratio is 1: 1.8.

[0027] The preparation method of wheat anti-low temperature regul...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a wheat low temperature resistance regulating agent and a using method thereof. The wheat low temperature resistance regulating agent comprises the following components in parts by weight: 20-30 parts of betaine, 10-15 parts of chitosan, 5-10 parts of salicylic acid, 6-13 parts of potassium silicate, 2-8 parts of a surfactant, 1-5 parts of a dispersant and 20-30 parts of water. The wheat low temperature resistance regulating agent has the beneficial effects as follows: the wheat low temperature resistance regulating agent uses water as a medium, so that the wheat low temperature resistance regulating agent has significant environment and social benefits and is beneficial to body health of an operator and the safety is improved; resistance inducing substances are compounded, so that the wheat low temperature resistance regulating agent can promote enzyme transformation, enhance the cell activity, improve the comprehensive resistance of a plant to low temperature stress, increase the chlorophyll content and the photosynthesis speed rate, and ensure the normal growth and development of the plant; active components are rich in source and renewable, are easily degraded in the natural environment and are free of pollution to soil, so that the wheat low temperature resistance regulating agent is easy to popularize and apply and has a positive role in promoting wheat production in China.

Description

technical field [0001] The invention relates to the field of pesticide plant growth regulators, in particular to a wheat low temperature resistance regulator and its application method. Background technique [0002] Wheat is an important food crop in my country. The residents in northern China take pasta as a staple food, and wheat is the raw material for flour processing. At present, my country's wheat sowing area is 30 million hectares, with an annual output of 120 million tons. Wheat has strong adaptability and a wide planting range, and is widely distributed in 30 provinces, municipalities and autonomous regions in my country. Wheat has a long growth period, sowing in autumn, harvesting in summer after winter, spring, and summer. Therefore, low temperature chilling injury and freezing injury have always been the main obstacles to the high and stable yield of wheat. Wheat freezing injury has a high frequency, large area, and serious damage. One of the main natural disast...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A01N59/00A01N43/16A01N37/46A01N37/40A01P21/00
CPCA01N59/00A01N37/40A01N37/46A01N43/16
Inventor 孙琦
Owner 兰溪市酉泽饲料技术服务有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com