Wheat low temperature resistance regulating agent and using method thereof
A regulator, anti-low temperature technology, applied in the directions of plant growth regulators, plant growth regulators, botanical equipment and methods, etc., can solve problems such as unsatisfactory effects, achieve good health, easy degradation, and improve comprehensive resistance. force effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0014] Wheat anti-low temperature regulator, the ingredients and parts by weight are: 22 parts of betaine, 12 parts of chitosan oligosaccharide, 8 parts of salicylic acid, 10 parts of potassium silicate, 5 parts of surfactant, 0.2 part of protein polypeptide, 2 parts of dispersant 24 parts of water. The surfactant is one or two mixtures of Tween series and / or Span series; the amino acid sequence of the protein peptide is HSHACVCVNCFCCGAAKCYLCRVLHPGKLCVCNCSK, and the protein peptide can be directly converted into amino acids by microorganisms to accelerate the proliferation of microorganisms. A large number of microorganisms will secrete metabolites such as microbial polysaccharides and organic acids, which can improve soil water and fertilizer retention, aeration, and the ability to regulate heat and cold; the dispersant is alkyl naphthalene sulfonate and polycarboxylate, and the weight ratio is 1: 1.
[0015] The preparation method of wheat anti-low temperature regulator is:...
Embodiment 2
[0020] Wheat anti-low temperature regulator, the ingredients and parts by weight are: 30 parts of betaine, 10 parts of chitosan oligosaccharide, 6 parts of salicylic acid, 8 parts of potassium silicate, 6 parts of surfactant, 0.4 part of protein polypeptide, 2 parts of dispersant 24 parts of water. The surfactant is one or two mixtures of Tween series and / or Span series; the amino acid sequence of the protein peptide is HSHACVCVNCFCCGAAKCYLCRVLHPGKLCVCNCSK, and the protein peptide can be directly converted into amino acids by microorganisms to accelerate the proliferation of microorganisms. A large number of microorganisms will secrete metabolites such as microbial polysaccharides and organic acids, which can improve soil water and fertilizer retention, aeration, and the ability to regulate heat and cold; the dispersant is alkyl naphthalene sulfonate and polycarboxylate, and the weight ratio is 1: 1.5.
[0021] The preparation method of wheat anti-low temperature regulator is...
Embodiment 3
[0026] Wheat anti-low temperature regulator, the ingredients and parts by weight are: 25 parts of betaine, 12 parts of chitosan oligosaccharide, 8 parts of salicylic acid, 12 parts of potassium silicate, 6 parts of surfactant, 0.3 part of protein polypeptide, 4 parts of dispersant part, 25 parts of water. The surfactant is one or two mixtures of Tween series and / or Span series; the amino acid sequence of the protein peptide is HSHACVCVNCFCCGAAKCYLCRVLHPGKLCVCNCSK, and the protein peptide can be directly converted into amino acids by microorganisms to accelerate the proliferation of microorganisms. A large number of microorganisms will secrete metabolites such as microbial polysaccharides and organic acids, which can improve soil water and fertilizer retention, aeration, and the ability to regulate heat and cold; the dispersant is alkyl naphthalene sulfonate and polycarboxylate, and the weight ratio is 1: 1.8.
[0027] The preparation method of wheat anti-low temperature regul...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More