Unlock instant, AI-driven research and patent intelligence for your innovation.

Method of diagnosing, monitoring, staging, imaging and treating gastrointestinal cancer

a gastrointestinal cancer and imaging technology, applied in the field of gastrointestinal cancer detection, diagnosis, staging, imaging and treating cancer, can solve the problems of recurrence and metastasis, bowel obstruction and bowel perforation are indicators of poor prognosis, and much rarer types of cancer

Inactive Publication Date: 2005-06-09
MACINA ROBERTO +2
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

[0021] Toward these ends, and others, it is an object of the present invention to provide a method for diagnosing the presence of gastrointestinal cancer by analyzing for changes in levels of GSG in cells, tissues or bodily fluids compared with levels of GSG in preferably the same cells, tissues, or bodily fluid type of a normal human control, wherein a change in levels of GSG in the patient versus the normal human control is associated with gastrointestinal cancer.

Problems solved by technology

However, recurrence and metastases following surgery is a major problem and often is the ultimate cause of death.
For example, bowel obstruction and bowel perforation are indicators of poor prognosis.
However, age greater than 70 years at presentation is not a contraindication to standard therapies; acceptable morbidity and mortality, as well as long-term survival, are achieved in this patient population.
However, this is a much rarer type of cancer.
This cancer is often difficult to diagnose in early stages and can be in the stomach for a long time, growing to a large size before symptoms arise.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

example 1

Relative Quantitation of Gene Expression

[0136] Real-Time quantitative PCR with fluorescent Taqman probes is a quantitation detection system utilizing the 5′-3′ nuclease activity of Taq DNA polymerase. The method uses an internal fluorescent oligonucleotide probe (Taqman) labeled with a 5′ reporter dye and a downstream, 3′ quencher dye. During PCR, the 5′-3′ nuclease activity of Taq DNA polymerase releases the reporter, whose fluorescence can then be detected by the laser detector of the Model 7700 Sequence Detection System (PE Applied Biosystems, Foster City, Calif., USA).

[0137] Amplification of an endogenous control is used to standardize the amount of sample RNA added to the reaction and normalize for Reverse Transcriptase (RT) efficiency. Either cyclophilin, glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ATPsy6 (ATP synthase 6), or 18S ribosomal RNA (rRNA) is used as this endogenous control. To calculate relative quantitation between all the samples studied, the target RNA l...

example 2

Expression of Cln114 in E. coli

[0154] Cln114 was amplified by polymerase chain reaction (PCR) using colon cDNA libraries and Cln specific primers. The amplified DNA fragment encoding amino acid number 1 (Met1) to amino acid number 323 (Ile323) of Cln114 was subcloned in a T7 RNA polymerase-based system (pET-21d) for expression in E. coli. In addition to Cln114 DNA coding sequence (Met1-Ile323), codons for six histidines, flanking the COOH-terminus of Cln114, were incorporated to use as purification tag.

(SEQ ID NO:13)Cln114 Construct: Met1-Ile323(His)6NH2 / MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQIHHHHHH / COOH

A high level of Cln114 expression was observed when the plasmid construct was transformed in E. co...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
paramagneticaaaaaaaaaa
weight lossaaaaaaaaaa
sizeaaaaaaaaaa
Login to View More

Abstract

The present invention provides new methods and agents for detecting, diagnosing, monitoring, staging, prognosticating, imaging and treating gastrointestinal cancer.

Description

[0001] This application claims the benefit of priority from U.S. Provisional Application Ser. No. 60 / 188,061, filed Mar. 9, 2000.FIELD OF THE INVENTION [0002] This invention relates, in part, to newly developed assays and compositions for detecting, diagnosing, monitoring, staging, prognosticating, imaging and treating cancers, particularly gastrointestinal cancers including stomach, small intestine and colon cancer. BACKGROUND OF THE INVENTION [0003] Cancer of the colon is the second most frequently diagnosed malignancy in the United States, as well as the second most common cause of cancer death. Colon cancer is a highly treatable and often curable disease when localized to the bowel. Surgery is the primary treatment and results in cure in approximately 50% of patients. However, recurrence and metastases following surgery is a major problem and often is the ultimate cause of death. [0004] Due to its proximity, cancer of the colon often metastasizes to the small intestine. The prog...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): A61K49/16A61K51/10G01N33/574
CPCA61K49/16Y10T436/25G01N33/57446A61K51/1063
Inventor MACINA, ROBERTOPIDERIT, ALEJANDRASUN, YONGMNG
Owner MACINA ROBERTO
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More