Novel small-molecule polypeptide blocking hepatitis B virus infection
A technology of hepatitis B virus and small molecule polypeptide, applied in the field of genetic engineering
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0020] The object of the present invention can be achieved through the following measures:
[0021] 2. The present invention selects the 2-48, 2-38 and 2-28 amino acids of the pre-S1 region of the hepatitis B virus B genotype envelope protein to design small molecular polypeptides, which are characterized in that they contain the following three amino acid sequences: A kind of:
[0022] (1) - GTNLSTSNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPDANKVG
[0023] (2) - GTNLSTSNPLGFFPDHQLDPAFKANSENPDWDLNPNK
[0024] (3)-GTNLSTSNPLGFFPDHQLDPAFKANSE
[0025] 1. In vitro pharmacodynamic studies:
[0026] 1. Synthesis and preparation of HBV PreS peptides: The selected HBV PreS peptides were respectively modified and modified by N-terminal myristoylation, and the production process, quality inspection and preliminary stability research were carried out.
[0027] 2. Isolation and culture of primary woodchuck hepatocytes (TH): woodchucks are primates, susceptible to woodchuck hepatitis virus (WH...
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com