Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

A technology for platelet aggregation and plasminogen, which is applied in biochemical equipment and methods, medical preparations containing active ingredients, enzymes, etc., and can solve the problem of no anti-platelet aggregation.

Inactive Publication Date: 2011-08-17
ZHENGZHOU UNIV
View PDF3 Cites 152 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0005] Experiments have shown that human tiny plasminogen has strong and rapid fibrinolytic activity, can effectively dissolve thrombus both in vivo and in vitro, and has a good application prospect, but it has no anti-platelet aggregation function, so if it can pass some The method introduces this property, so that it has the functions of fibrinolysis and platelet aggregation inhibition, which will be more conducive to development and utilization

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof
  • Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof
  • Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0027] The present invention will be described in further detail below in conjunction with the accompanying drawings.

[0028] For the tiny plasminogen mutant of the present invention, the polypeptide coding sequence containing the KGD sequence is fused to the tiny plasminogen gene when synthesizing the tiny plasminogen mutant gene.

[0029] According to the structural characteristics and mode of action of microplasminogen, a bifunctional mutant molecule of microplasminogen capable of dissolving thrombus and inhibiting platelet aggregation is designed, and produced by genetic engineering. The obtained product not only has efficient and specific thrombolytic function In addition, it also has new properties of anti-platelet aggregation, and the preparation process is simple and safe.

[0030] From the perspective of the three-dimensional structure of tiny plasminogen, the 7-10 amino acids are located outside the molecular structure, presenting a prominent Loop shape, away from t...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.

Description

technical field [0001] The invention relates to the field of biotechnology, in particular to a tiny plasminogen mutant with the function of inhibiting platelet aggregation, and the invention also relates to a preparation method of the tiny plasminogen mutant and its preparation for preventing and treating thrombotic diseases. Use in pharmaceuticals and ophthalmic disease medicines. Background technique [0002] Human plasminogen (Plasminogen, Plg) is one of the key components of the human fibrinolytic system. After being activated by plasminogen activator (PA) and converted into plasmin (Plasmin, Plm), it not only exerts fibrinolytic effect , dissolve thrombus, and participate in a series of physiological and pathological processes related to proteolysis in the body. Natural Glu-Plg is a glycoprotein with multiple domains, consisting of N-terminal polypeptide (NTP), 5 homologous triangular regions (K1-K5), and serinase active center region (SP). After activation by PA , sp...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C12N9/68A61K38/48A61P7/02A61P27/02
Inventor 方惠敏卢萍张守涛
Owner ZHENGZHOU UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap