Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

523 results about "Thrombotic disease" patented technology

Thrombotic thrombocytopenic purpura (TTP) is a rare blood disorder characterized by clotting in small blood vessels (thromboses), resulting in a low platelet count.In its full-blown form, the disease consists of the following pentad: Microangiopathic hemolytic anemia. Thrombocytopenic purpura.

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Carbon monoxide as a biomarker and therapeutic agent

The present invention relates to the use of carbon monoxide (CO) as a biomarker and therapeutic agent of heart, lung, liver, spleen, brain, skin and kidney diseases and other conditions and disease states including, for example, asthma, emphysema, bronchitis, adult respiratory distress syndrome, sepsis, cystic fibrosis, pneumonia, interstitial lung diseases, idiopathic pulmonary diseases, other lung diseases including primary pulmonary hypertension, secondary pulmonary hypertension, cancers, including lung, larynx and throat cancer, arthritis, wound healing, Parkinson's disease, Alzheimer's disease, peripheral vascular disease and pulmonary vascular thrombotic diseases such as pulmonary embolism. CO may be used to provide anti-inflammatory relief in patients suffering from oxidative stress and other conditions especially including sepsis and septic shock. In addition, carbon monoxide may be used as a biomarker or therapeutic agent for reducing respiratory distress in lung transplant patients and to reduce or inhibit oxidative stress and inflammation in transplant patients.
Owner:THE JOHN HOPKINS UNIV SCHOOL OF MEDICINE

Ether compounds

The present invention relates to novel ether compounds, compositions comprising ether compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising an ether compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing Alzheimer's Disease, Syndrome X, peroxisome proliferator activated receptor-related disorders, septicemia, thrombotic disorders, obesity, pancreatitis, hypertension, renal disease, cancer, inflammation, and impotence. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Sulfoxide and bis-sulfoxide compounds and compositions for cholesterol management and related uses

The present invention relates to novel sulfoxide and bis-sulfoxide compounds, compositions comprising sulfoxide and bis-sulfoxide compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising an ether compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing Alzheimer's Disease, Syndrome X, peroxisome proliferator activated receptor-related disorders, septicemia, thrombotic disorders, obesity, pancreatitis, hypertension, renal disease, cancer, inflammation, and impotence. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Ketone compounds and compositions for cholesterol management and related uses

The present invention relates to novel ketone compounds, compositions comprising ketone compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising a ketone compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing Alzheimer's Disease, Syndrome X, peroxisome proliferator activated receptor-related disorders, septicemia, thrombotic disorders, obesity, pancreatitis, hypertension, renal disease, cancer, inflammation, and impotence. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Nanotherapeutics for drug targeting

The invention provides compositions and methods for targeted controlled drug release. The compositions and methods can be used for treating or imaging vascular stenosis, stenotic lesions, occluded lumens, embolic phenomena, thrombotic disorders and internal hemorrhage.
Owner:PRESIDENT & FELLOWS OF HARVARD COLLEGE

Dihydroxyl compounds and compositions for cholesterol management and related uses

ActiveUS20040214887A1BiocideSenses disorderBile productionDiabetic retinopathy
The present invention relates to novel dihydroxyl compounds, compositions comprising hydroxyl compounds, and methods useful for treating and preventing a variety of diseases and conditions such as, but not limited to aging, Alzheimer's Disease, cancer, cardiovascular disease, diabetic nephropathy, diabetic retinopathy, a disorder of glucose metabolism, dyslipidemia, dyslipoproteinemia, hypertension, impotence, inflammation, insulin resistance, lipid elimination in bile, obesity, oxysterol elimination in bile, pancreatitis, Parkinson's disease, a peroxisome proliferator activated receptor-associated disorder, phospholipid elimination in bile, renal disease, septicemia, metabolic syndrome disorders (e.g., Syndrome X), thrombotic disorder. Compounds and methods of the invention can also be used to modulate C reactive protein or enhance bile production in a patient. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Dipeptide analogs as coagulation factor inhibitors

Disclosed are novel dipeptide analogs compounds of Formula (I), (II) or (III):or a stereoisomer, a tautomer, a pharmaceutically acceptable salt, a solvate, or a prodrug thereof, which are inhibitors of factor XIa and / or plasma kallikrein, compositions containing them, and methods of using them, for example, for the treatment or prophylaxis of thrombotic diseases.
Owner:BRISTOL MYERS SQUIBB CO

Oligomerization pineapple ginseng glycosaminoglycan and preparation method thereof

ActiveCN101724086AGood anticoagulant and antithrombotic activityOrganic active ingredientsBlood disorderMonosaccharide compositionEnzyme inhibitor
The invention discloses oligomerization pineapple ginseng glycosaminoglycan (dTHG). The weight-average molecular weight of the glycosaminoglycan is 8,000-20,000Da, and monosaccharide constituents comprise acetylgalactosaminyl (GaLNAc), glucuronic acid (GLcUA), fucose (Fuc) or sulfuric ester thereof (expressed by -OSO3-), wherein the molar ratio of the GaLNAc to the GLcUA to the Fuc to the -OSO3- is about 1:(+ / -0.3):(1+ / -0.3):(3.5+ / -0.5). The dTHG is a powerful endogenous factor X enzyme inhibitor, has good anticoagulation and anti-thrombus activity and can be used for preventing and / or treating thrombotic diseases. The invention also provides a method for preparing the dTHG, comprising the following steps of: (1) extracting and obtaining fucose glycosaminoglycan (THG) from the walls of pineapple ginseng bodies; (2) adopting a peroxide method or a peroxide method under the catalysis of an ionic catalyst of transition metal of the fourth period to depolymerize the THF so as to obtain dTHG; and (3) removing low molecular and / or high molecular impurity constituents in the dTHG.
Owner:SHENZHEN NEPTUNUS PHARM CO LTD

Nutritional blend oil with balanced fatty acid component and active component for middle and old aged

The invention relates to a nutritional blend oil with balanced fatty acid components and active components for the middle and old aged, which is prepared by a plurality of plant oils selected from flaxseed oil, walnut oil, double-low rapeseed oil, soybean oil, wheat germ oil, corn oil, teal oil, peanut oil, grape seed oil, rice bran oil, camellia oil, evening primrose seed oil, sunflower seed oil and the like, wherein, Omega 6 serial polyunsaturated fatty acids (PUFA) and Omega 3 serial PUFA are contained to enable the ratio of saturated fatty acid (SFA) to monounsaturated fatty acid (MUFA) to PUFA to be 0.6-0.8:1:1, the ratio of Omega 6 to Omega 3 to be 4:1 in the comprehensive evaluation of the blend oil absorbed by the middle and old aged and the fat from other sources, thereby meeting the recommended value of Chinese Nutrition Society; the nutritional blend oil contains 2% of gama-linolenic acid, thereby beneficial to improving the contents of DH-gama-linolenic acid and arachidonic acid; the total content of lauric acid, myristic acid and palmitic acid contained in the nutritional blend oil is below 8.5% in order to avoid over rising the level of Low density lipoprotein (LDL) in the plasm of the middle and old aged; in addition, the nutritional blend oil also comprises a plurality of active components with oxidation resistant property, so other antioxidants do not need to be added in the blend oil.The blend oil provided by the invention is characterized by low cost, balanced fatty acid nutrition, a plurality of abundant active components and higher security, thereby better improving the health and intelligence of eaters, preventing cardiovascular and cerebrovascular diseases, and avoiding fatness, hyperlipidemia, thrombotic diseases and the like caused by unbalanced fatty nutrition.
Owner:ZHEJIANG OIL MASTER

Ketone compounds and compositions for cholesterol management and related uses

The present invention relates to novel ketone compounds, compositions comprising ketone compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising a ketone compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing Alzheimer's Disease, Syndrome X, peroxisome proliferator activated receptor-related disorders, septicemia, thrombotic disorders, obesity, pancreatitis, hypertension, renal disease, cancer, inflammation, and impotence. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Anti-Thrombotic Agents

The present invention embodies: methods; compounds, their pharmaceutically acceptable analogs, isomer, salts, hydrates, solvates and prodrug derivatives, and pharmaceutically acceptable compositions thereof that have particular biological properties; devices; diagnostic and other assays; and the uses of such methods, compounds, devices and assays. Common throughout these embodiments is specific selective reduction of intravascular thromboplastin antecedent activity, which results in a safe antithrombotic effect. A particularly prominent application or the invention relates to diagnosis and treatment of patients which have, or are at risk of, developing thrombosis, thrombotic injury, or vaso-occlusive diseases, such as myocardial infarction, stroke, restenosis after angioplasty, thrombotic diseases, etc. Another particularly prominent feature of the present invention is its high level of hemostatic safety at optimal efficacy. Also, the present invention is compatible for use in combination with other traditional therapeutic agent such as another antithrombotic, antiplatelet, thrombolytic, or anticoagulant agents.
Owner:GRUBER ANDRAS

Aptamers to von Willebrand Factor and their use as thrombotic disease therapeutics

The invention relates generally to the field of nucleic acids and more particularly to aptamers capable of binding to von Willebrand Factor useful as therapeutics in and diagnostics of thrombotic diseases and / or other diseases or disorders in which von Willebrand Factor mediated platelet aggregation has been implicated. The invention further relates to materials and methods for the administration of aptamers capable of binding to von Willebrand Factor.
Owner:ARCHEMIX CORP

Fucosylated glycosaminoglycan derivative and preparation method thereof

InactiveCN102329397APotent anticoagulant activityOrganic active ingredientsBlood disorderOrganosulfateCarboxylic ester
The invention discloses a carboxylic ester of fucosylated glycosaminoglycan (CEFG) with anticoagulation activity, a pharmaceutically acceptable salt thereof, a preparation method of the CEFG and the pharmaceutically acceptable salt thereof, a pharmaceutical composition containing the CEFG or the salt thereof, and application of the pharmaceutical composition in preparation of anticoagulants. The monosaccharides for preparing the CEFG comprise D-glucuronic acid or D-glucuronate (D-GlcU), D-2-deoxy-2-acetyl galactosamine sulfate (D-GalNAcS) and L-fucose sulfate (L-FucS), wherein the molar ratio of D-GlcU to D-GalNAc to L-Fuc to -OSO3<-> is 1:(1+ / -0.3):(1+ / -0.3):(3.5+ / -0.5); the esterification degree of the D-GlcU is not lower than 20%; and the weight average molecular weight of the CEFG is 3000-20000 Da. The glycosylated chondroitin sulfate esterification derivative has strong anticoagulation activity, and can be applied in preparation of drugs for preventing and / or treating thrombotic diseases.
Owner:KUNMING INST OF BOTANY - CHINESE ACAD OF SCI

Ketone compounds and compositions for cholesterol management and related uses

The present invention relates to novel ketone compounds, compositions comprising ketone compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising a ketone compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing Alzheimer's Disease, Syndrome X, peroxisome proliferator activated receptor-related disorders, septicemia, thrombotic disorders, obesity, pancreatitis, hypertension, renal disease, cancer, inflammation, and impotence. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Aptamers to von Willebrand Factor and their use as thrombotic disease therapeutics

The invention relates generally to the field of nucleic acids and more particularly to aptamers capable of binding to von Willebrand Factor useful as therapeutics in and diagnostics of thrombotic diseases and / or other diseases or disorders in which von Willebrand Factor mediated platelet aggregation has been implicated. The invention further relates to materials and methods for the administration of aptamers capable of binding to von Willebrand Factor.
Owner:ARCHEMIX CORP

Therapeutic use of soluble CD39L3

ActiveUS7247300B1Enhance ADPase activityDiminish unwanted related activityHydrolasesPeptide/protein ingredientsDiseasePlatelet inhibition
The present invention provides soluble forms of CD39L3 polypeptides and compositions, and methods useful inhibiting platelet activation and recruitment for the treatment and prevention of thrombotic disorders in mammals administered with soluble forms of CD39L3 polypeptides.
Owner:ASTRAZENECA AB

Carbon monoxide as a biomarker and therapeutic agent

The present invention relates to the use of carbon monoxide (CO) as a biomarker and therapeutic agent of heart, lung, liver, spleen, brain, skin and kidney diseases and other conditions and disease states including, for example, asthma, emphysema, bronchitis, adult respiratory distress syndrome, sepsis, cystic fibrosis, pneumonia, interstitial lung diseases, idiopathic pulmonary diseases, other lung diseases including primary pulmonary hypertension, secondary pulmonary hypertension, cancers, including lung, larynx and throat cancer, arthritis, wound healing, Parkinson's disease, Alzheimer's disease, peripheral vascular disease and pulmonary vascular thrombotic diseases such as pulmonary embolism. CO may be used to provide anti-inflammatory relief in patients suffering from oxidative stress and other conditions especially including sepsis and septic shock. In addition, carbon monoxide may be used as a biomarker or therapeutic agent for reducing respiratory distress in lung transplant patients and to reduce or inhibit oxidative stress and inflammation in transplant patients.
Owner:THE JOHN HOPKINS UNIV SCHOOL OF MEDICINE

Ketone compounds and compositions for cholesterol management and related uses

The present invention relates to novel ketone compounds, compositions comprising ketone compounds, and methods useful for treating and preventing cardiovascular diseases, dyslipidemias, dysproteinemias, and glucose metabolism disorders comprising administering a composition comprising a ketone compound. The compounds, compositions, and methods of the invention are also useful for treating and preventing Alzheimer's Disease, Syndrome X, peroxisome proliferator activated receptor-related disorders, septicemia, thrombotic disorders, obesity, pancreatitis, hypertension, renal disease, cancer, inflammation, and impotence. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Depolymerization glycosaminoglycan extracted from sea cucumber composition and its preparation method and application

The invention relates to a de-polymerizing sea cucumber glycosamino-glycan compound, comprising 90-99. 89% of de-polymerizing sea cucumber glycosamino-glycan with weight average molecular weight being between 8000Da to 120000Da. The preparation method comprises following steps: (1) extracting sea cucumber polysaccharides from sea cucumber; (2) degrading extracted polysaccharides; (3) collecting de-polymerizing sea cucumber glycosamino-glycan with weight average molecular weight being between 8000Da to 120000Da. The compound can prevent and treat cerebrovascular disease and cardiovascular disease, especially blood coagulation disease and thrombus disease. The raw material is sea creature, so the source is abundant and cost is low.
Owner:XIAN XINTONG PHARM RES CO LTD

Methods for modulating Lyn kinase activity and treating related disorders

The present invention relates to compounds and pharmaceutically acceptable salts thereof and formulations comprising the compounds or a pharmaceutically acceptable salts thereof that are useful in modulating lyn kinase activity. In particular, the compounds or a pharmaceutically acceptable salts thereof are useful for treating or preventing a disease or disorder including cardiovascular disease, dyslipidemia, dyslipoproteinemia, a disorder of glucose metabolism, metabolic syndrome (i.e., Syndrome X), a peroxisome proliferator activated receptor-associated disorder, septicemia, a thrombotic disorder, type II diabetes, obesity, pancreatitis, hypertension, renal disease, inflammation, or impotence.
Owner:MELIOR DISCOVERY INC

Shear controlled release for stenotic lesions and thrombolytic therapies

The invention provides compositions and methods for treating or imaging stenosis, stenotic lesions, occluded lumens, embolic phenomena or thrombotic disorders. The invention further provides compositions and methods for treating internal hemorrhage.
Owner:PRESIDENT & FELLOWS OF HARVARD COLLEGE

Diagnostic tool detecting the degradation status of Von Willebrand Factor multimers

A method in which the cleavage profile and size distribution of von Willebrand factor (VWF) multimers is analyzed, includes: providing a sample medium of human body fluids comprising a plurality of VWF multimers of different size; enrichment or purification of the VWF multimers by cryoprecipitation or chromatography to obtain a separated preparation of the VWF multimers from said sample medium; exposing the separated preparation of VWF multimers to a light source to produce signals obtained by vibrational spectroscopy; detecting said signals; transformation by mathematical alogrithms; generation of patterns based on computing of data of original resonance spectra and determining the cleavage profile and the size distribution of said separated VWF multimers by chemometrics; and acquisition of a databank obtained from healthy individuals for identifying subjects at risk of developing at least one of the following diseases: sepsis, coagulopathy, thrombotic disease, infection, and inflammation.
Owner:BOCKMEYER CLEMENS +2

Fuc3S4S substituted oligo-glycosaminoglycan and preparation method thereof

The invention discloses a Fuc3S4S substituted oligo-glycosaminoglycan with the weight-average molecular weight of about 4.5-9kD, a medicine composition containing the Fuc3S4S substituted oligo-glycosaminoglycan, preparation methods thereof and an application thereof in preparing medicines for preventing or treating thrombotic diseases. The oligo-glycosaminoglycan has a structure shown as the formula (I); in the formula (I), a substituent group is defined as the specification. The Fuc3S4S substituted oligo-glycosaminoglycan and the medicine composition thereof have strong-effect factor X enzyme inhibition activity and HC-II depended antithrombase activity, and can be used for preparing antithrombus medicines.
Owner:JIUZHITANG +2

Cycloalkyl-hydroxyl compounds and compositions for cholesterol management and related uses

The present invention relates to novel cycloalkyl-hydroxyl compounds, compositions comprising hydroxyl compounds, and methods useful for treating and preventing a variety of diseases and conditions such as, but not limited to aging, Alzheimer's Disease, cancer, cardiovascular disease, diabetic nephropathy, diabetic retinopathy, a disorder of glucose metabolism, dyslipidemia, dyslipoproteinemia, hypertension, impotence, inflammation, insulin resistance, lipid elimination in bile, obesity, oxysterol elimination in bile, pancreatitis, Parkinson's disease, a peroxisome proliferator activated receptor-associated disorder, phospholipid elimination in bile, renal disease, septicemia, Syndrome X, thrombotic disorder. Compounds and methods of the invention can also be used to modulate C reactive protein or enhance bile production in a patient. In certain embodiments, the compounds, compositions, and methods of the invention are useful in combination therapy with other therapeutics, such as hypocholesterolemic and hypoglycemic agents.
Owner:ESPERION THERAPEUTICS

Medicine for treating cardiovascular disease

Disclosed is a medicament for treating cardiovascular diseases which comprises the following raw materials: glossy ganoderma extract, hooked uncaria, fleece-flower root, root of bidentate achyranthes, Ligusticum wallichii, epimeddium, dodder seed, cassia seed, cape jasmine, rhubarb horsetails, banksia rose, dahurian angelica root, root of herbaceous peony, Chinese angelica root, iron ocher, poria cocos wolf, pinellia tuber, rough gentian, Chinese yam, capsule of weeping forsythia, wild chrysanthemum flower, dried orange peel, cinnabar.
Owner:包德圻

Dipeptide analogs as coagulation factor inhibitors

Disclosed are novel dipeptide analogs compounds of Formula (I), (II) or (III):or a stereoisomer, a tautomer, a pharmaceutically acceptable salt, a solvate, or a prodrug thereof, which are inhibitors of factor XIa and / or plasma kallikrein, compositions containing them, and methods of using them, for example, for the treatment or prophylaxis of thrombotic diseases.
Owner:BRISTOL MYERS SQUIBB CO
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More