Patents
Literature
PatSnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

1228 results about "Platelet aggregation" patented technology

Platelet aggregation is the clustering together of thrombocytes, which are the small, cell-like structures made in the bone marrow that help prevent bleeding. This clumping can occur in response to many different agents, including the nucleotide adenosine diphosphate (ADP), and the proteins thrombin and collagen.

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Optimized stent jacket

ActiveUS20100241214A1Reducing platelet aggregationReduce aggregationStentsSurgeryFiberAdditive ingredient
A method of stenting, comprises: implanting a stent assembly in a vessel of a subject, the stent assembly, including: a stent jacket, comprising an expansible mesh structure, formed of fibers of a diameter between about 7 micrometers and about 18 micrometers, the diameter having a property of forming a substantially stable layer of endothelial cells, covering the fibers, thus reducing platelet aggregation, and an expansible stent, operatively associated with the stent jacket. The method further comprises administering to the subject an active pharmaceutical ingredient (API) comprising a platelet aggregation reducer for a shortened time period, not exceeding six months, the shortened time period being a consequence of the property. In accordance with some embodiments, the administration of a platelet aggregation.
Owner:INSPIRE M D LTD

Compounds and methods for delivery of prostacyclin analogs

This invention pertains generally to prostacyclin analogs and methods for their use in promoting vasodilation, inhibiting platelet aggregation and thrombus formation, stimulating thrombolysis, inhibiting cell proliferation (including vascular remodeling), providing cytoprotection, preventing atherogenesis and inducing angiogenesis. Generally, the compounds and methods of the present invention increase the oral bioavailability and circulating concentrations of treprostinil when administered orally. Compounds of the present invention have the following formula:
Owner:UNITED THERAPEUTICS CORP

System/unit and method employing a plurality of magnetoelastic sensor elements for automatically quantifying parameters of whole blood and platelet-rich plasma

InactiveUS20080261261A1Quantifying platelet-fibrin clot strengthBioreactor/fermenter combinationsBiological substance pretreatmentsClot formationBlood plasma
A system / analyzer-unit and method / platform—using information obtained from at least one, adapted for a plurality of, magnetoelastic sensor elements in contact with one or more samples comprising blood from a patient—for automatically quantifying one or more parameters of the patient's blood. Information obtained from emissions measured from each of the sensor elements is uniquely processed to determine a quantification about the patient's blood, such as, quantifying platelet aggregation to determine platelet contribution toward clot formation; quantifying fibrin network contribution toward clot formation; quantifying platelet-fibrin clot interactions; quantifying kinetics of thrombin clot generation; quantifying platelet-fibrin clot strength; and so on. Structural aspects of the analyzer-unit include: a cartridge having at least one bay within which a sensor element is positioned; each bay in fluid communication with both (a) an entry port for injecting a first blood sample composed of blood taken from the patient (human or other mammal), and (b) a gas vent through which air displaced by injecting the first blood sample into the bay.
Owner:KMG2 SENSORS CORP

Composition and method for inhibiting platelet aggregation

The present invention provides novel compounds of dinucleotide polyphosphates and the method of preventing or treating diseases or conditions associated with platelet aggregation. The method comprises administering systemically to a patient a pharmaceutical comprising a purinergic P2τ receptor antagonist, in an amount effective to elevate its extracellular concentration to bind to P2τ receptors and inhibit P2τ receptor-mediated platelet aggregation. Methods of systemic administration include injection by intravenous, intramuscular, intrasternal and intravitreal routes, infusion, transdermal administration, oral administration, rectal administration and intra-operative instillation.
Owner:INSPIRE PHARMA +1

Nanoparticulate clopidogrel and aspirin combination formulations

The present invention is directed to compositions comprising a nanoparticulate clopidogrel and aspirin combination, or salts or derivatives thereof, having improved clopidogrel bioavailability. The nanoparticulate clopidogrel particles, and optionally the nanoparticulate aspirin particles, of the composition have an effective average particle size of less than about 2000 nm and are useful in the prevention and treatment of pathologies induced by platelet aggregation. The clopidogrel and aspirin particles may also be formulated as a controlled release polymeric coating or matrix drug delivery system.
Owner:ELAN PHRMA INT LTD

Recombinant fibrin chains, fibrin and fibrin-homologs

The invention is directed to fibrin materials for use in fibrin compositions and methods that avoid the need to use thrombin as an activating agent for fibrin monomer-based sealants. The invention provides for substantially pure fibrin chains, fibrin chain precursors, fibrin chains with other N-terminal extensions, fibrin monomer, fibrin-homolog and fibrin-analog. The invention further provides for variant fibrin .gamma.-chains. The variant gamma-chain contains one or more mutations and / or deletions in the C-terminal region following the coiled-coil forming region such that, when incorporated into fibrin-homolog, the homolog lacks the ability to self-polymerize but has the ability to form non-covalent bonds, and thereby form mixed polymers useful as sealants, with fibrinogen. The invention also provides nucleotide sequences encoding fibrin chains or fibrin chain variants and cells expressing fibrin chains, fibrin chain variants, fibrin monomer, fibrin precursor or fibrinogen-analog. The invention further provides a method of forming fibrin-related proteins in vitro from their component fibrin chains. The invention additionally provides a method for forming a fibrin sealant by a reacting a first fibrin-related protein that is incapable of self-polymerizing with a second fibrin-related protein that is incapable of self-polymerizing. Fibrin chains produced by methods of the present invention may be used as sources of substantially pure starting material for the production of important fibrin-derived factors that regulate angiogenesis, platelet aggregation, and other physiological processes.
Owner:BRISTOL MYERS SQUIBB CO

Modified annexin proteins and methods for preventing thrombosis

A modified annexin protein, preferably annexin V, is used to prevent thrombosis without increasing hemorrhage. Annexin binds to phosphatidylserine on the outer surface of cell membranes, thereby preventing binding of the prothrombinase complex necessary for thrombus formation. It does not, however, affect platelet aggregation necessary for hemostasis. The modified annexin molecule can be a homodimer of annexin, an annexin molecule coupled to one or more polyethylene glycol chains, or an annexin molecule coupled to another protein. By increasing the molecular weight of annexin, the modified annexin is made to remain in circulation for sufficient time to provide a sustained therapeutic effect.
Owner:ALAVITA PHARMA

Quinoline derivatives as pi3 kinase inhibitors

Invented is a method of inhibiting the activity / function of PI3 kinases using quinoline derivatives. Also invented is a method of treating one or more disease states selected from: autoimmune disorders, inflammatory diseases, cardiovascular diseases, neurodegenerative diseases, allergy, asthma, pancreatitis, multiorgan failure, kidney diseases, platelet aggregation, cancer, sperm motility, transplantation rejection, graft rejection and lung injuries by the administration of quinoline derivatives.
Owner:GLAXO SMITHKLINE LLC

Platelet aggregation inducing substance

A platelet aggregation inducing substance containing as an active ingredient a polypeptide having a peptide fragment represented by formula (1) (component A):-(Pro-X-Gly)n-   (1)wherein X represents Pro or Hyp; and n represents an integer of from 20 to 5,000.
Owner:JNC CORP

Intracellular calcium concentration increase inhibitors

An intracellular calcium concentration increase inhibitor containing as the active ingredient (1) a boron compound represented by the formula (I).The compound represented by the formula (I) inhibits the increase of the intracellular calcium concentration, and therefore it is deemed to be useful as an agent for the prophylaxis and / or treatment of platelet aggregation, ischemic diseases in hearts and brains, immune deficiency diseases, allorgosis, bronchial asthma, hypertension, cerebrovascular spasm, various renal diseases, pancreatitis, Alzheimer's disease, etc.
Owner:MIKOSHIBA KATSUHIKO

Pharmaceutical Compositions of a 5-HT2A Serotonin Receptor Modulator Useful for the Treatment of Disorders Related Thereto

InactiveUS20090053306A1Organic active ingredientsBiocideDiseaseAcute schizophrenia
The present invention relates to certain pharmaceutical compositions of a 5-HT2A serotonin receptor modulator and methods for preparing pharmaceutical composition related thereto. The pharmaceutical compositions are useful in the treatment of platelet aggregation, coronary artery disease, myocardial infarction, transient ischemic attack, angina, stroke, atrial fibrillation, reducing the risk of blood clot formation, asthma or symptoms thereof, agitation or a symptom, behavioral disorders, drug induced psychosis, excitative psychosis, Gilles de la Tourette's syndrome, manic disorder, organic or NOS psychosis, psychotic disorder, psychosis, acute schizophrenia, chronic schizophrenia, NOS schizophrenia and related disorders, sleep disorders, diabetic-related disorders, progressive multifocal leukoencephalopathy and the like.
Owner:ARENA PHARMA

Method for preparing clopidogrel and its derivatives

The present invention relates to a method for preparing Clopidogrel and its derivatives. More particularly, the present invention is a method for preparation of (S)-2-Clopidogrel and its derivatives, which are active inhibitors of platelet aggregation, from an optically active (S)-2-chlorophenyl glycine alkyl ester through hydrolysis of racemic 2-chlorophenylglycine alkyl esters using an enzyme. The present invention employs a simple procedure to prepare Clopidogrel and its derivatives. Because no chiral resolving agents are used except for a small amount of enzyme, the cost of preparation can be reduced. In addition, the present invention is suitable for synthesizing highly optical-active Clopidogrel and its derivatives on a large scale by using optically active (S)-2-chlorophenylglycine alkyl ester obtained in high yield as an intermediate, and is also environmentally friendly since no highly toxic reagents are employed.
Owner:ENZYTECH LTD

Beta-tetrahydro carboline carboxylic acid, its RGD conjugate, their synthesis and medical application

The present invention relates to the synthesis of beta-tetrahydro carboline carboxylic acid and its nanoparticle preparation; liquid phase process of gradually grafting peptide to obtain protected tetrapeptide intermediate, which, after eliminating its Boc, is condensated with N-Boc-beta-tetrahydro carboline carboxylic acid and further HF treated to eliminate its protection to obtain the said compound; the nanoparticle of tetrahydro carboline carboxylic acid and the in-vitro and in-vivo activity of said compound in-vitro and in-vivo experiments show that the compound of the present invention has excellent activity of resisting blood platelet aggregation, effect of resisting cell adhesion and effect of resisting thrombus.
Owner:ZHEJIANG MEDICINE CO LTD XINCHANG PHAMACEUTICAL FACTORY

Two dimensional polymer that generates nitric oxide

A polymeric composition that generates nitric oxide and a process for rendering the surface of a substrate nonthrombogenic by applying a coating of the polymeric composition to the substrate are disclosed. The composition comprises: (1) a crosslinked chemical combination of (i) a polymer having amino group-containing side chains along a backbone forming the polymer, and (ii) a crosslinking agent containing functional groups capable of reacting with the amino groups; and (2) a plurality of nitric oxide generating functional groups associated with the crosslinked chemical combination. Once exposed to a physiological environment, the coating generates nitric oxide thereby inhibiting platelet aggregation. In one embodiment, the nitric oxide generating functional groups are provided by a nitrated compound (e.g., nitrocellulose) imbedded in the polymeric composition. In another embodiment, the nitric oxide generating functional groups comprise N2O2− groups covalently bonded to amino groups on the polymer.
Owner:MICHIGAN BIOTECH INST

Tubiflorous desert cistanche prepn containing phenethyl alcohol glycoside and its prepn process and use

The tubiflorous desert cistanche preparation containing phenethyl alcohol glycoside contains echinacoside in 10-70 wt% and acteoside in 1-40 wt%. The preparation of the present invention may be applied as active component for preparing medicine treating and preventing senile dementia and for preparing medicine inhibiting platelet aggregation.
Owner:JIANGSU KANION PHARMA CO LTD

5-thia-omega-substituted phenyl-prostaglandin E derivatives, process for producing the same and drugs containing the same as the active ingredient

The present invention relates to 5-thia-omega-substituted phenylprostaglandin E derivatives of the formula (I)(wherein, all the symbols are as defined in the specification), process for producing them and pharmaceutical compositions comprising them as active ingredient.The compounds of the formula (I) can bind to PGE2 receptors (especially, subtype EP4) strongly, so they are expected to be useful for prevention and / or treatment of immunological diseases (autoimmune diseases such as amyotrophic lateral sclerosis (ALS), multiple sclerosis, Sjoegren's syndrome, chronic rheumarthrosis and systemic lupus erythematosus etc., and rejection after organ transplantation etc.), asthma, abnormal bone formation, neuronal cell death, lung failure, liver damage, acute hepatitis, nephritis, renal insufficiency, hypertension, myocardiac ischemia, systemic inflammatory response syndrome, ambustion pain, sepsis, hemophagous syndrome, macrophage activation syndrome, Still's disease, Kawasaki disease, burn, systemic granulomatosis, ulcerative colitis, Crohn's disease, hypercytokinemia at dialysis, multiple organ failure, and shock etc. Further, it is thought that EP4 subtype receptor relates to sleeping disorder and blood platelet aggregation, so the compounds of the present invention are expected to be useful for the prevention and / or treatment of such diseases.
Owner:ONO PHARMA CO LTD

Wound healing with zeolite-based hemostatic devices

A method for decreasing the time it takes for a wound to heal includes applying hemostatic agent to the wound, inflaming tissue surrounding the wound to facilitate the deposition of fibroblast, thereby accelerating the subsequent contraction of the wound and the onset of the proliferative healing stage, and causing the re-epithelization of the tissue at a faster rate than if no hemostatic agent was applied. A method for promoting the healing of a bleeding wound includes coating a hemostatic agent onto a substrate, applying the substrate to the bleeding wound so that an effective amount of the hemostatic agent is applied to the wound, inflaming the tissue, and causing the re-epithelization of the tissue at a faster rate than if no hemostatic agent was applied. In at least some methods, a clotting cascade and platelet aggregation within the bleeding wound is accelerated, and blood loss from the wound is decreased.
Owner:TELEFLEX LIFE SCI LTD

Orally bioavailable compounds and methods for inhibiting platelet aggregation

This invention is directed to a method of preventing or treating diseases or conditions associated with platelet aggregation. The method is also directed to a method of treating thrombosis or related disorders. The method comprises administering to a subject a pharmaceutical composition comprising an effective amount of a non-nucleotide compound, preferably a P2Y12 receptor antagonist compound, wherein said amount is effective to inhibit platelet aggregation. The compounds useful for this invention include compounds of general Formulae III, IIIa, and IIIb, or salts, hydrates, and solvates thereof. The present invention also provides novel compounds of Formulae IIIa and IIIb, which are potent and have a good oral bioavailability.
Owner:INSPIRE PHARMA

Thiophenopyridine substituted acetyl hyarazine derivative

The present invention discloses thiopheno pyridine substituted acetyl hyarazine derivative compound as shown in expression I and its pharmaceutically acceptable salt, medicine composition with the compound as effective component, and their application as platelet aggregation resisting medicine, especially as medicine for preventing and treating platelet aggregation caused coronary artery syndromes, myocardial infarction, myocardial ischemia and other cardiac and cerebral vascular diseases.
Owner:TIANJIN INSTITUTE OF PHARMA RESEARCH

Antibody of human origin for inhibiting thrombocytes aggregation

The present invention is directed to an antibody or derivative thereof of human origin for inhibiting platelet aggregation, characterized in that it is effective by substantially exclusive binding to the activated state of platelet integrin receptor GPIIb / IIIa.
Owner:AFFIMED THERAPEUTICS AG

Quinoxaline derivatives as PI3 kinase inhibitors

Invented is a method of inhibiting the activity / function of PI3 kinases using quinoxaline derivatives. Also invented is a method of treating one or more disease states selected from: autoimmune disorders, inflammatory diseases, cardiovascular diseases, neurodegenerative diseases, allergy, asthma, pancreatitis, multiorgan failure, kidney diseases, platelet aggregation, cancer, sperm motility, transplantation rejection, graft rejection and lung injuries by the administration of quinoxaline derivatives.
Owner:GLAXO SMITHKLINE LLC

Nitrosated and nitrosylated rapamycin compounds, compositions and methods of use

The invention describes novel nitrosated and / or nitrosylated rapamycin compounds, and novel compositions comprising at least one nitrosated and / or nitrosylated rapamycin compound, and, optionally, at least one nitric oxide donor compound. The invention also provides novel compositions comprising at least one rapamycin compound and at least one nitric oxide donor compound and / or at least one therapeutic agent. The compounds and compositions of the invention can also be bound to a matrix. The invention also provides methods for treating and / or preventing cardiovascular diseases, for the prevention of platelet aggregation and platelet adhesion caused by the exposure of blood to a medical device, for treating and / or preventing pathological conditions resulting from abnormal cell proliferation; transplantation rejections; autoimmune, inflammatory, proliferative, hyperproliferative or vascular diseases; for reducing scar tissue or for inhibiting wound contraction, particularly the prophylactic and / or therapeutic treatment of restenosis by administering nitrosated and / or nitrosylated rapamycin compounds or rapamycin compounds in combination with nitric oxide donors that are capable of releasing nitric oxide or indirectly delivering or transferring nitric oxide to targeted sites under physiological conditions.
Owner:NICOX SA

Cold storage solution for organ and biological tissue preservation

Cold storage solutions for the preservation of organs and biological tissues prior to implantation, including a prostaglandin having vasodilatory, membrane stabilizing, platelet aggregation prevention upon reperfusion, and complement activation inhibitory properties, a nitric oxide donor, and a glutathione-forming agent.
Owner:ORGAN RECOVERY SYST

Formulation of a mixture of Free-B-Ring flavonoids and flavans as a therapeutic agent

InactiveUS20060204596A1Decreasing and eliminating side effectEliminate side effectsBiocideAntipyreticSide effectTherapeutic effect
The present invention provides a composition of matter comprised of a mixture of two specific classes of compounds—Free-B-Ring flavonoids and flavans—referred to herein as UP736 for use in the prevention and treatment of diseases and conditions related to platelet aggregation and platelet-induced thrombosis. The invention further provides a novel composition of matter comprised of UP736 in combination with injectable or oral anticoagulants, antiplatelet agents, non-steroidal anti-inflammatory drugs (NSAIDs) and COX-2 selective inhibitors and a method for using said composition in the prevention and treatment of diseases and conditions related to platelet aggregation and platelet-induced thrombosis. Finally, this invention provides a method for using UP736 in combination with anti-platelet, anti-coagulant, prophylaxis agents and NSAIDs as a means for reducing the dosage of these agents, decreasing the side effects associated with acute or chronic administration of these agents; counteracting or antagonizing the risks of acute or chronic administration of these agents and for achieving additional and / or multiple clinical benefits.
Owner:UNIGEN

System and method for adjustment of blood separation procedure parameters

Systems and methods are provided for automatically adjusting the operational parameters of a blood separation procedure. A blood separation device has an inlet for passing fluid thereinto and an outlet for removing fluid therefrom. A pump system is provided for moving fluid into and out of the device. In use, blood is conveyed into the device, where platelets are separated from at least a portion of the blood. A controller determines the amount of platelets in the device. Based at least in part on the amount of platelets in the device, corrective action is taken to avoid platelet aggregation in the device. The corrective action may be conveying an elevated amount of anticoagulant into the blood and / or the device and may be initiated when the determined amount of platelets approaches, meets, or exceeds a threshold predicted likelihood of platelet aggregation.
Owner:FENWAL

Preparation method of anticoagulation polylactic acid hemodialysis membrane

The invention discloses a preparation method of an anticoagulation polylactic acid hemodialysis membrane. Cellulose acetate membranes and polysulfone membranes are widely used in current clinical application. Poly lactic acid has a good membrane-forming property, but is inclined to hydrophobicity, and blood contacting materials are often required to have good hydrophilicity, can reduce the protein adsorption on material surfaces and reduce platelet aggregation. In the preparation method, firstly a polylactic acid hollow fiber membrane with epoxy groups is prepared by a one-step method, then diamine activation of the polylactic acid hollow fiber membrane is carried out, finally heparin is introduced into the activated polylactic acid hollow fiber membrane to obtain the anticoagulation polylactic acid hemodialysis membrane. In the preparation method, the polylactic acid is used as a dialysis membrane material, and the novel dialysis membrane is prepared through use of the wet / dry solution spinning method; and through in-situ polymerization of monomers having double bonds and the epoxy groups, groups of high reaction activity are introduced into a polylactic acid matrix, and reaction conditions of subsequent diamine grafting process and heparin fixing process are mild, so the method is a simple and convenient modification method.
Owner:NINGBO INST OF MATERIALS TECH & ENG CHINESE ACADEMY OF SCI

Inhibitors of protein kinases

InactiveCN102066338AInhibits syk kinase activityNervous disorderOrganic chemistryKinase activityJanus kinase
The present invention is directed to compounds of formula (I)-(II) and pharmaceutically acceptable salts, esters, and prodrugs thereof which are inhibitors of syk and / or JAK kinase. The present invention is also directed to intermediates used in making such compounds, the preparation of such a compound, pharmaceutical compositions containing such a compound, methods of inhibition syk and / or JAK kinase activity, methods of inhibition the platelet aggregation, and methods to prevent or treat a number of conditions mediated at least in part by syk and / or JAK kinase activity, such as undesired thrombosis and Non Hodgkin's Lymphoma.
Owner:PORTOLA PHARMA INC