Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

281 results about "Ophthalmic disease" patented technology

Ophthalmic Diseases. Canine Diseases. Cataracts Though many people mistakenly believe cataracts are a cloudy film on the surface of the eye, cataracts are actually opacities within the lens, located inside the eye.

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Ophthalmic formulations and uses thereof

ActiveUS20060183698A1RestoringBiocideSenses disorderDiseaseSerum electrolytes
Provided by the present invention are compositions or formulations suitable for application to a patient's eyes which utilizes a topical ophthalmically-acceptable formulation comprising a therapeutically-effective amount of an ophthalmically-active antimicrobial agent, and an ophthalmically-active anti-inflammatory or steroidal agent in combination with physiologic levels of serum electrolytes in an ophthalmic formulation for the treatment of changes in the normal eye condition. The invention also includes methods of treating patient's having an ophthalmic disease, injury or disorder, utilizing the compositions or formulations. Also provided are kits comprising the compositions or formulations and a means of applying the compositions or formulation to the patient's eyes.
Owner:BAUSCH & LOMB INC

Systems and methods using weighted-ensemble supervised-learning for automatic detection of ophthalmic disease from images

Disclosed herein are systems, methods, and devices for classifying ophthalmic images according to disease type, state, and stage. The disclosed invention details systems, methods, and devices to perform the aforementioned classification based on weighted-linkage of an ensemble of machine learning models. In some parts, each model is trained on a training data set and tested on a test dataset. In other parts, the models are ranked based on classification performance, and model weights are assigned based on model rank. To classify an ophthalmic image, that image is presented to each model of the ensemble for classification, yielding a probabilistic classification score—of each model. Using the model weights, a weighted-average of the individual model-generated probabilistic scores is computed and used for the classification.
Owner:RETINA AI HEALTH INC

Deep learning-based diagnosis and referral of ophthalmic diseases and disorders

Disclosed herein are systems, methods, devices, and media for carrying out medical diagnosis of ophthalmic diseases and conditions. Deep learning algorithms enable the automated analysis of ophthalmic images to generate predictions of comparable accuracy to clinical experts.
Owner:AITECH +1

Methods and compositions for killing senescent cells and for treating senescence-associated diseases and disorders

Methods are provided herein for selectively killing senescent cells and for treating senescence-associated diseases and disorders by administering a senolytic agent. Senescence-associated diseases and disorders treatable by the methods using the senolytic agents described herein include cardiovascular diseases and disorders associated with or caused by arteriosclerosis, such as atherosclerosis; idiopathic pulmonary fibrosis; chronic obstructive pulmonary disease; osteoarthritis; senescence-associated ophthalmic diseases and disorders; and senescence-associated dermatological diseases and disorders.
Owner:MAYO FOUND FOR MEDICAL EDUCATION & RES +3

Amelioration of macular degeneration and other ophthalmic diseases

InactiveUS20050130906A1Preventing/treating damageAvoid delayBiocideSenses disorderUveitisDisease
Methods for the treatment or prevention of a number of ocular diseases or disorders are disclosed. In particular, methods are disclosed for the amelioration of macular degeneration, diabetic retinopathy and other retinopathies, as well as uveitis, presbyopia, dry eye, glaucoma, blepharitis and rosacea of the eye. The methods comprise administration of a compositions comprising an ophthalmologically acceptable carrier or diluent and a hydoxylamine compound in a therapeutically sufficient amount to prevent, retard the development or reduce the symptoms of one or more of the ophthalmic conditions.
Owner:COLBY PHARMA CO

Electromagnetic apparatus for prophylaxis and repair of ophthalmic tissue and method for using same

An apparatus and method for altering the electromagnetic environment of ophthalmic tissues, cells, and molecules comprising, establishing baseline thermal fluctuations in voltage and electrical impedance at a target pathway structure depending on a state of at least one of the ophthalmic tissue components, configuring at least one waveform to have sufficient signal to noise ratio to modulate at least one of ion and ligand interactions whereby the at least one of ion and ligand interactions are detectable in the target pathway structure above the established baseline thermal fluctuations in voltage and electrical impedance, generating an electromagnetic signal from the configured at least one waveform, and coupling the electromagnetic signal to the target pathway structure using a coupling device whereby enhancing the release of second messengers, such as NO, growth factors and cytokines at the target pathway structure. The use of the within specified electromagnetic waveforms can have particular utility in the prophylactic treatment of ophthalmic tissue and the treatment of ophthalmic diseases such as macular degeneration, glaucoma, retinosa pigmentosa, repair and regeneration of optic nerve prophylaxis and other related diseases that respond positively to the physiological effects of these waveforms.
Owner:RIO GRANDE NEUROSCI

Therapeutic Agent For Ophthalmic Diseases

A therapeutic agent for ophthalmic diseases containing Laennec (trade name) as an active ingredient. Laennec, the active ingredient, exhibits a therapeutic effect on a wide variety of ophthalmic diseases by increasing tears and the like and is highly safe even though it is an animal-derived component. Therefore, the therapeutic agent is applicable to the prevention and / or treatment of various types of ophthalmic diseases, particularly corneal disorders, dry eye, asthenopia, inflammatorily ophthalmic diseases (e.g., meibomian gland dysfunction, Stevens-Johnson syndrome, Sjogren syndrome, uveitis) and ophthalmic diseases caused by active oxygen (e.g., cataract, glaucoma, age-related macular degeneration, optic disc atrophy).
Owner:HIBINO SAWAKO

Method for treating ophthalmic diseases using rho kinase inhibitor compounds

This invention is directed to methods of preventing or treating ocular diseases with inflammation, excessive cell proliferation, remodeling, neurite retraction, corneal neurodegeneration, excessive vaso-permeability and edema. Particularly, this invention relates to methods treating ocular diseases such as allergic conjunctivitis, corneal hyposensitivity, neurotrophic keratopathy, dry eye disease, proliferative vitreal retinopathy, macular edema, macular degeneration, and blepharitis, using novel Rho kinase inhibitor compounds. The method comprises identifying a subject in need of the treatment, and administering to the subject an effective amount of a novel Rho kinase inhibitor compound to treat the disease.
Owner:INSPIRE PHARMA

Percutaneous absorption preparation for treating ophthalmic disease, use thereof and method for migration of ophthalmic remedy into topical tissue in eye

InactiveUS20060036220A1Efficacy can be sustainedly developedCan be sustainedly developedSenses disorderAntipyreticDiseaseEyelid
A transdermal drug delivery system for treatment of ophthalmic diseases comprising a structure that a plaster layer containing a remedy for ophthalmic diseases is provided on a support, wherein the system is applied to a skin surface including a front surface of an eyelid to administer the remedy for ophthalmic diseases in the plaster layer to an ophthalmic topical tissue by percutaneous permeation substantially without being administered through a systemic blood flow. Use of the transdermal drug delivery system for treatment of ophthalmic diseases, comprising applying the transdermal drug delivery system to a skin surface including a front surface of an eyelid to transfer the remedy for ophthalmic diseases in the plaster layer to an ophthalmic topical tissue by percutaneous permeation substantially without being administered through a systemic blood flow, and a method for transferring the remedy for ophthalmic diseases to the ophthalmic topical tissue.
Owner:SENJU PHARMA CO LTD

Topical, periocular, or intraocular use of tocotrienols for the treatment of ophthalmic diseases

InactiveUS20120136048A1Avoid it happening againBiocideSenses disorderDiseaseOphthalmic Agents
A method for preventing, reducing, ameliorating or treating ophthalmic disorders associated with neurodegenerative diseases or trauma, comprising the topical, periocular, or intraocular application of an ophthalmic formulation comprising a therapeutically effective amount of one or more ophthalmic agents selected from the group consisting of alpha-tocotrienol, beta-tocotrienol, gamma-tocotrienol, delta-tocotrienol, or esters or mixtures thereof is disclosed. Use of tocotrienols for the prevention, reduction, amelioration or treatment of ophthalmic disorders that are, or that are associated with, mitochondrial diseases is also discussed. Topical ophthalmic formulations comprising tocotrienols are also discussed.
Owner:AMPERE LIFE SCI

Nitrosated nonsteroidal antiinflammatory compounds, compositions and methods of use

InactiveUS7163958B2Unexpected potential for facilitating wound healingImprove bioavailabilityBiocideSenses disorderDiseaseAntiinflammatory drug
The invention describes novel nitrosated nonsteroidal antiinflammatory drugs (NSAIDs) and pharmaceutically acceptable salts thereof, and novel compositions comprising at least one nitrosated NSAID, and, optionally, at least one compound that donates, transfers or releases nitric oxide, stimulates endogenous synthesis of nitric oxide, elevates endogenous levels of endothelium-derived relaxing factor or is a substrate for nitric oxide synthase, and / or at least one therapeutic agent. The invention also provides novel compositions comprising at least one nitrosated NSAID, and at least one compound that donates, transfers or releases nitric oxide, elevates endogenous levels of endothelium-derived relaxing factor, stimulates endogenous synthesis of nitric oxide or is a substrate for nitric oxide synthase and / or at least one therapeutic agent. The invention also provides novel kits comprising at least one nitrosated NSAID, and, optionally, at least one nitric oxide donor and / or at least one therapeutic agent. The invention also provides methods for treating inflammation, pain and fever; for treating gastrointestinal disorders; for facilitating wound healing; for treating and / or preventing gastrointestinal, renal and / or respiratory toxicities resulting from the use of nonsteroidal antiinflammatory compounds; for treating inflammatory disease states and / or disorders; and for treating and / or preventing ophthalmic diseases and / or disorders.
Owner:NICOX SA

Bifunctional rho kinase inhibitor compounds, composition and use

This invention relates to synthetic bifunctional compounds comprising a first rho-associated kinase (ROCK) inhibiting compound and a second pharmaceutically active compound with complementary activity; the first and the second compounds are covalently linked by a biologically labile bond. This invention also relates to methods of making such compounds. The invention also relates to methods of using such bifunctional compounds in the prevention or treatment of diseases or conditions that are affected or can be assisted by altering the integrity or rearrangement of the cytoskeleton. Particularly, this invention relates to methods of treating ophthalmic diseases such as disorders in which intraocular pressure is elevated, for example primary open-angle glaucoma, using the bifunctional compounds.
Owner:INSPIRE PHARMA

Method for treating ophthalmic diseases using kinase inhibitor compounds in prodrug forms

This invention is directed to prodrugs of rho kinase (ROCK) inhibitors. These prodrugs are in general the ester or the amide derivatives of the parent compounds. These prodrugs are often weak inhibitors of ROCK, but their parent compounds have good activities. Upon instillation into the eyes, the ester or the amide group of these prodrugs is rapidly hydrolyzed into alcohol, amine, or acid, and the prodrugs are converted into the active base compounds. The prodrugs of ROCK inhibitors provide several advantages such as delivery of higher concentrations of the active species into the target site and reduction of ocular discomfort. The invention is also directed to a method of treating ophthalmic diseases such as glaucoma, allergic conjunctivitis, macular edema, macular degeneration, and blepharitis, by administering an effective amount of a ROCK prodrug compound of Formula I to the eyes of the patient in need of.
Owner:MERCK SHARP & DOHME CORP

Amelioration of cataracts, macular degeneration and other ophthalmic diseases

InactiveUS20050131025A1Halts development of cataractsInhibit progressBiocidePharmaceutical delivery mechanismDiseaseUveitis
Ophthalmically acceptable compositions used in arresting the development of cataract, presbyopia, macular degeneration and other retinopathies, glaucoma, uveitis and various corneal disorders are disclosed. The compositions are also useful as a prophylactic treatment to prevent or delay development of age-related ocular disorders, which include cataracts, presbyopia, glaucoma and macular degeneration. The compositions comprise a pharmaceutically acceptable carrier or diluent and at least one compound having the formula: [0001]where R1 and R2 are, independently, H or C1 to C3 alkyl; [0002]R3 and R4 are, independently C1 to C3 alkyl; and [0003]where R1 and R2, taken together, or R3 and R4, taken together, or both may be cycloalkyl; [0004]R5 is H, OH, or C1 to C6 alkyl; [0005]R6 is or C1 to C6 alkyl, alkenyl, alkynyl, or substituted alkyl or alkenyl; [0006]R7 is C1 to C6 alkyl, alkenyl, alkynyl, or substituted alkyl or alkenyl or where R6 and R7, or R5, R6 and R7, taken together, form a carbocycle or heterocycle having from 3 to 7 atoms in the ring.
Owner:COLBY PHARMA CO

Spectacles for treating or assistance treating oculopathy such as short sight and method for making same

The researcher of the invention increases a way of an eyesight training device and a removable type message device based on the a common use window area; and a pair of eyeglasses and a preparation method used for the remedy and the auxiliary remedy of the myopia and other ophthalmic diseases are given additionally. The invention is used for the remedy and the auxiliary remedy of sight fatigue, near vision, far sight, weak sight and presbyopia; wherein, the common use sight window area, which gradually guides the length of an optic axis to drive to a normal situation through the defocus of the eyeglasses in the front view direction; the eyesight training device of the eyeglasses, which guide eyeballs to move through the eyesight training device of the eyeglasses, the eyeball drives spondylopathy to move and / or the eyeball drives the spondylopathy to move and to combine an image through the binoculus, and is used to perform a renaturation practice to ciliary muscle, crystalline lens, a visual cell, an optic nerve, a maincenter optic nerve and extraocular muscle; the massage device of the eyeglasses, which is used to regulate viscera and to dredge channels and through the message to a circumocular acupoint, to ensure that the genuine energy of the five viscera and six bowels to be filled into eyes.
Owner:丛繁滋

Methods for the treatment of diabetic retinopathy and other ophthalmic diseases

ActiveUS20140039048A1Reduce rod energy demandImprove retinal functionBiocideSenses disorderDiseaseDiabetic retinopathy
Methods are provided herein for the treatment of ophthalmic diseases or conditions such as an ophthalmic disease or disorder associated with diabetes in a patient. Also provided herein are methods of treating retinopathy of prematurity in a patient. Further, provided herein are methods for treating wet age-related macular degeneration in a patient. The methods comprise administration of compounds disclosed herein to a patient in need thereof that inhibit or slow one or more signs or symptoms of such conditions.
Owner:ACUACELA INC

Novel ep4 agonist

ActiveUS20110098481A1Weaken agonist actionMaintaining blood concentrationBiocideOrganic chemistryCarbon numberHepatic lipase
Provided is a compound represented by the formula (1):wherein R1 and R2 are each independently a hydrogen atom or a straight chain alkyl group having a carbon number of 1-3, R3 is a hydrogen atom, an alkyl group having a carbon number of 1-4, an alkoxyalkyl group, an aryl group, a halogen atom or a haloalkyl group, or a pharmaceutically acceptable salt thereof, which has, unlike known PGI2 analogs, a selective EP4 agonist action, and a medicament containing the compound, which is useful for the prophylaxis and / or treatment of immune diseases, diseases of the digestive tract, cardiovascular diseases, cardiac diseases, respiratory diseases, neurological diseases, ophthalmic diseases, renal diseases, hepatic diseases, bone diseases, skin diseases and the like.
Owner:ASAHI GLASS CO LTD

Methods and compositions for killing senescent cells and for treating senescence-associated diseases and disorders

Methods are provided herein for selectively killing senescent cells and for treating senescence-associated diseases and disorders by administering a senolytic agent. Senescence-associated diseases and disorders treatable by the methods using the senolytic agents described herein include cardiovascular diseases and disorders associated with or caused by arteriosclerosis, such as atherosclerosis; idiopathic pulmonary fibrosis; chronic obstructive pulmonary disease; osteoarthritis; senescence-associated ophthalmic diseases and disorders; and senescence-associated dermatological diseases and disorders.
Owner:THE JOHN HOPKINS UNIV SCHOOL OF MEDICINE +3

Ocular devices

Ocular devices are provided for placement in the upper fornix of the eye and having a body that encompasses a low-level light source, an energy source, a microcontroller, and an antenna for delivering a programmable, fade in-out, light therapy regimen to treat neurological and ophthalmic diseases and disorders. In one embodiment the ocular device delivers a programmable green light therapy to reduce elevated intraocular pressure (IOP) and retinal hypoxia during the nocturnal period, that is, when these risk factors are at their highest level especially in glaucoma, age-related macular degeneration and diabetic retinopathy patients.
Owner:ALVALUX MEDICAL

Multiple target point small interference RNA cocktail agent for treating ophthalmic disease and preparing method thereof

The invention discloses a multi-target small-interfering RNA cocktail preparation for treating ophthalmic diseases and the preparation method. The multi-target small-interfering-RNA cocktail preparation is composed of three or more than three small-interfering RNA aiming to three or more than three different genes and knocking down simultaneously a plurality of pathogenic genes; the multi-target small-interfering-RNA cocktail preparation is prepared by a plurality of small-interfering RNA in a certain proportion according to different diseases. The multi-target small-interfering-RNA cocktail preparation is a plurality of double-bond RNA molecules of different lengths from 19to 27nt, with blunt ends or overhanging ends; the RNA sequence in the multi-target small-interfering-RNA cocktail preparation has the homology to the gene targets of human, rat and other nonhuman primate; . The multi-target small-interfering-RNA cocktail preparation aiming to the following gene sequences: (1) virus-affection-related gene; (2) inflammation-arosing gene; (3) neovescular-related gene. The invention provides a novel treatment for a plurality of ophthalmic diseases, including retinopathy of prematurity, senile fundus macula lutea, retinopathy caused by senile diabetes, herpes simplex corneal stromal opacification and uveitis.
Owner:广州拓谱基因技术有限公司