Patents
Literature
PatSnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

2163 results about "OPHTHALMOLOGICALS" patented technology

Hydrophilic Polysiloxane Macromonomer, and Production and Use of the same

Problem to be Solved To provide an ophthalmic lens, which can be more safely worn, that is, to provide a material, which is transparent and has high oxygen permeability and a high hydrophilic property, and to provide a novel monomer to be a raw material thereof.Solution A hydrophilic polysiloxane macromonomer contains polyoxyethylene as a hydrophilic side chains in a polysiloxane main chain, wherein transparency, oxygen permeability, and hydrophilic properties of the material are controlled by regulating the length of the polysiloxane main chain, the length of the hydrophilic polyoxyethylene side chains, and the number of the side chains.
Owner:COOPERVISION INT LTD

Ophthalmology implants and methods of manufacture

The present disclosure provides an ophthalmology implant and methods for treating glaucoma or optic neural transmission deficiency, wherein at least a portion of the implant is made of or includes a nanometer-sized substance, such as nanotubes, nanofibers, sheets from nanotubes, nanowires, nanofibrous mesh and the like.
Owner:GLAUKOS CORP

Inhibition of irritating side effects associated with use of a topical ophthalmic medication

This invention relates to a method of reducing an irritating or adverse side effect associated with the topical use of an active ophthalmic drug comprising incorporating an effective amount of a cyclodextrin or cyclodextrin derivative into a formulation to complex the active drug such that the concentration of the free active drug is reduced below a tolerable threshold, and incorporating an effective amount of a viscosity increasing agent in said formulation such that the bioavailability of said drug is high enough to be therapeutically effective, wherein the cyclodextrin or cyclodextrin derivative is not required to solubilize the active drug. Another aspect of this invention relates to topical ophthalmic formulations comprising an active drug, a cyclodextrin or cyclodextrin derivative, and a viscosity-enhancing agent, in effective amounts as stated above.
Owner:ALLERGAN INC

Production of ophthalmic devices based on photo-induced step growth polymerization

The invention provide a new lens curing method for making hydrogel contact lenses. The new lens curing method is based on actinically-induced step-growth polymerization. The invention also provides hydrogel contact lenses prepared from the method of the invention and fluid compositions for making hydrogel contact lenses based on the new lens curing method. In addition, the invention provide prepolymers capable of undergoing actinically-induced step-growth polymerization to form hydrogel contact lenses.
Owner:ALCON INC

Method and Device for Ophthalmic Administration of Active Pharmaceutical Ingredients

Disclosed is the use of a mist of a pharmaceutical composition for ophthalmic delivery of a protein or peptide active pharmaceutical ingredient, a related method of treatment and a device useful in implementing the use and method. Disclosed is also the use of a mist for ophthalmic delivery of a pharmaceutical composition including a highly irritating penetration enhancer and an ophthalmically acceptable carrier, a related method of treatment and a device useful in implementing the use and method. Disclosed is also a device for ophthalmic administration configured to direct a mist of a pharmaceutical composition to the eye only when the eye is open. Disclosed is also a self-sterilizing device for ophthalmic administration. Disclosed is also a device and a method for increasing the bioavailability of an ophthalmically administered API in a pharmaceutical composition.
Owner:PHARMALIGHT

C-shaped cross section tubular ophthalmic implant for reduction of intraocular pressure in glaucomatous eyes and method of use

A tube for implantation into the eye for replacement conduction of aqueous humor from the chambers of the eyeball to the subconjunctival tissue and ultimately to the venous system is comprised of an elongated fluid conducting conduit having distal and proximate ends, a sidewall and an interior passageway and at least one longitudinally extending opening in the sidewall that exposes the interior passageway and at least one nidi-forming structure carried by the conduit and extending laterally therefrom to implement the formation of at least one aqueous filtration bleb in the tissue of the eyeball. In one embodiment, the tube also contains at least one releasable ligature circumscribing the conduit. In another embodiment, the tube also contains an anchor appended to the conduit to prevent it from migrating from its placement site.
Owner:AQ BIOMED LLC

Silicone hydrogels comprising n-vinyl amides and hydroxyalkyl (meth)acrylates or (meth)acrylamides

The present invention relates to a process comprising the steps of reacting a reactive mixture comprising at least one silicone-containing component, at least one hydrophilic component, and at least one diluent to form an ophthalmic device having an advancing contact angle of less than about 80°; and contacting the ophthalmic device with an aqueous extraction solution at an elevated extraction temperature, wherein said at least one diluent has a boiling point at least about 10° higher than said extraction temperature.
Owner:JOHNSON & JOHNSON VISION CARE INC

Systems and methods for tele-ophthalmology

InactiveUS20020052551A1Easy to optimizeSimple and accessible and economicalDiagnostic recording/measuringMedical imagesOPHTHALMOLOGICALSServer
The present invention provides systems and methods for screening and tracking ophthalmic disease in a plurality of patients. The invention includes a screening subsystem comprising a non-mydriatic camera for obtaining digital images of eyes of the patients, a central database for storing the digital images of the eyes of patients as well as patient demographic data and related health data, and a central server comprising a computer which executes retinopathy grading algorithms, wherein the retinopathy grading algorithms recognize and assign a grade to ophthalmic disease present in the digital eye image and store the results in the central database. The invention also provides a method for screening and tracking ophthalmic disease in a patient with the steps of obtaining digital images of eyes of the patient by means of a screening subsystem comprising a camera, transmitting the obtained digital image to a central database and to a central server, executing retinopathy grading algorithms that recognize and assign a grade to ophthalmic disease present in the digital eye images, and storing the transmitted digital images and the results of the retinopathy grading algorithms in the central database.
Owner:VIMETRICS

Ionic silicone hydrogels

The present invention relates to a process comprising the steps of reacting a reactive mixture comprising at least one silicone-containing component, at least one hydrophilic component, and at least one diluent to form an ophthalmic device having an advancing contact angle of less than about 80°; and contacting the ophthalmic device with an aqueous extraction solution at an elevated extraction temperature, wherein said at least one diluent has a boiling point at least about 10° higher than said extraction temperature.
Owner:JOHNSON & JOHNSON VISION CARE INC

Ophthalmic instrument with adaptive optic subsystem that measures aberrations (including higher order aberrations) of a human eye and that provides a view of compensation of such aberrations to the human eye

An improved ophthalmic instrument for in-vivo examination of a human eye including a wavefront sensor that estimates aberrations in reflections of the light formed as an image on the retina of the human eye and a phase compensator that spatially modulates the phase of incident light to compensate for the aberrations estimated by the wavefront sensor Optical elements create an image of a fixation target at the phase compensator, which produces a compensated image of the fixation target that compensates for aberrations estimated by the wavefront sensor. The compensated image of the fixation target produced by the phase compensator is recreated at the human eye to thereby provide the human eye with a view of compensation of the aberrations the human eye as estimated by the wavefront sensor. The phase compensator preferably comprises a variable focus lens that compensates for focusing errors and a deformable mirror that compensates for higher order aberrations. The optical elements preferably comprise a plurality of beam splitters and a plurality of lens groups each functioning as an afocal telescope. In addition, instruments and systems are provided that exploit these capabilities to enable efficient prescription and / or dispensing of corrective optics (e.g., contact lens and glasses).
Owner:NORTHROP GRUMMAN SYST CORP +1

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Polysaccharide-based polymer tissue adhesive for medical use

Tissue adhesives formed by reacting an oxidized polysaccharide with a water-dispersible multi-arm polyether amine, wherein at least three of the arms are terminated by primary amine groups, are disclosed. The use of the tissue adhesives for medical and veterinary applications such as topical wound closure; and surgical procedures, such as intestinal anastomosis, vascular anastomosis, tissue repair, and ophthalmic procedures; drug delivery; anti-adhesive applications; and as a bulking agent to treat urinary incontinence are described.
Owner:ACTAMAX SURGICAL MATERIALS

Cyclodextrin nanotechnology for ophthalmic drug delivery

ActiveUS20070020336A1Antibacterial agentsBiocideEye suspensionCyclodextrin
The invention provides an ophthalmic composition which is an aqueous suspension comprising drug, cyclodextrin and water, the composition having an aqueous phase of from about 0.1% (w / v) to about 90% (w / v) of the drug in solution, as dissolved free drug and as dissolved drug / cyclodextrin complex(es), and a solid phase of from about 10% (w / v) to about 99.9% (w / v) of the drug as solid drug / cyclodextrin particles, suspended in the aqueous phase; the size of the solid particles being from about 10 nm to about 1 mm, the drug / cyclodextrin particles being capable of dissolving in aqueous tear fluid within 24 hours of application to the eye surface. The aqueous eye suspension can be in the form of eye drops, eye gel or eye mist. Further, the invention provides a method for treating a condition of the posterior segment and / or anterior segment of the eye comprising applying to the eye surface, in an amount which delivers to said segment or segments a therapeutically effective amount of a drug suitable for treating said condition, an ophthalmic composition which is as defined above. Nasal compositions and methods and ophthalmic and nasal compositions in powder form are also provided.
Owner:OCULIS EHF

Polymer-based tissue-adhesive form medical use

Tissue adhesives formed by reacting poly(hydroxylic) compounds derivatized with acetoacetate groups and / or polyamino compounds derivatized with acetoacetamide groups with an amino-functional crosslinking compound are disclosed. The use of the tissue adhesives for medical and veterinary applications such as topical wound closure; and surgical procedures, such as intestinal anastomosis, vascular anastomosis, tissue repair, and ophthalmic procedures; drug delivery; and anti-adhesive applications are described.
Owner:ACTAMAX SURGICAL MATERIALS

Polymerizable chain-extended polysiloxanes with pendant hydrophilic groups

The invention provide a class of chain-extended polysiloxane crosslinkers which comprises (1) at least two polysiloxane segments, wherein each pair of adjacent polysiloxane segments is linked by one divalent organic radical which includes at least one pendant hydrophilic group (hydroxyl and / or carboxyl groups) or at least one dangling hydrophilic polymer chain and a di-thioether linkage —S-DR-S— in which DR is a divalent organic radical; and (2) two terminal ethylenically unsaturated groups. The present invention is also related to a polymer comprising crosslinking units derived from chain-extended polysiloxane crosslinker of the invention and to ophthalmic lenses comprising such a polymer.
Owner:ALCON INC

Opthalmic sensor

This invention is generally related to a biocompatible sensor for detecting / measuring sugar, especially glucose, in an ocular fluid in a non-invasive or minimally invasive manner and a method for using the biocompatible sensor. A biocompatible sensor of the invention comprises, consists essentially, or consists of an ophthalmic device comprising a molecular sensing moiety which interacts or, reacts with sugar to provide an optical signal which is indicative of sugar level in an ocular fluid.
Owner:EYESENSE AG

Ophthalmic instrument having an integral wavefront sensor and display device that displays a graphical representation of high order aberrations of the human eye measured by the wavefront sensor

An improved ophthalmic instrument including an integral wavefront sensor and display device, wherein the wavefront sensor measures phase aberrations in reflections directed thereto to characterize aberrations of the eye and is operably coupled to the display device, which displays a graphical representation of the aberrations of the eye. Such graphical representation may include: two dimensional contour maps that graphically depict contribution of pre-specified terms (such as spherical aberration, astigmatism and coma) for the aberrations of the eye, coefficients corresponding to such pre-specified terms that characterize the aberrations of the eye, or predefined two-dimensional icons that provide a general graphical depiction of such prespecified terms. Such graphical representations provide the practitioner with valuable information characterizing the high order optical errors of the eye (which is far beyond the diopter information typically provided by current ophthalmic instruments) for use in diagnosis and treatment of abnormalities and disease in the eye.
Owner:ADAPTIVE OPTICS ASSOC

Ophthalmic lens synthesized from its specification

This invention relates to a novel prescription lens (58), mainly suited for ophthalmic applications. The lens designer defines the macroscopic surfaces of the lens (59, 60) as desired. The design process assumes that the location of the object (50), the lens (51), and the required image (53) are known. By using Ray-tracing technique we calculate the microscopic normals to the lens that will form the required image. From those microscopic normals we calculate microscopic surface by a process of summation the slopes with geometric pattern conditions. The final surface is not smooth but contains plenty of dense microscopic shapes that look like saw-teeth. That rough surface enables the lens to have almost any desired shape and thickness.
Owner:GIL THIEBERGER

Ophthalmic formulations and uses thereof

ActiveUS20060183698A1RestoringBiocideSenses disorderDiseaseSerum electrolytes
Provided by the present invention are compositions or formulations suitable for application to a patient's eyes which utilizes a topical ophthalmically-acceptable formulation comprising a therapeutically-effective amount of an ophthalmically-active antimicrobial agent, and an ophthalmically-active anti-inflammatory or steroidal agent in combination with physiologic levels of serum electrolytes in an ophthalmic formulation for the treatment of changes in the normal eye condition. The invention also includes methods of treating patient's having an ophthalmic disease, injury or disorder, utilizing the compositions or formulations. Also provided are kits comprising the compositions or formulations and a means of applying the compositions or formulation to the patient's eyes.
Owner:BAUSCH & LOMB INC

Delivery device and method of delivery

An ophthalmic delivery device includes a body defining a fluid reservoir and a pump in fluid communication with the reservoir. The delivery device also includes a nozzle that includes a dosage chamber for holding a dosage of fluid, a valve seat, and a valve cover. The valve cover extends about the valve seat and forms an interface therebetween and the valve seat includes an outlet aperture. The interface is in fluid communication with the outlet aperture and the dosage chamber, and at least part of the valve cover is movable between (i) a closed position with the valve cover engaging the valve seat to close the interface and form a fluid-tight seal therebetween, and (ii) an open position with at least part of the valve cover spaced away from the valve seat in response to fluid flowing through the outlet aperture at a pressure greater than a valve opening pressure to allow the passage of pressurized fluid therebetween. The valve seat and the valve cover are dimensioned to dispense the dosage of fluid through the interface at a velocity of equal to or less than 6 meters per second.
Owner:MEDICAL INSTILL TECH

Systems and methods using weighted-ensemble supervised-learning for automatic detection of ophthalmic disease from images

Disclosed herein are systems, methods, and devices for classifying ophthalmic images according to disease type, state, and stage. The disclosed invention details systems, methods, and devices to perform the aforementioned classification based on weighted-linkage of an ensemble of machine learning models. In some parts, each model is trained on a training data set and tested on a test dataset. In other parts, the models are ranked based on classification performance, and model weights are assigned based on model rank. To classify an ophthalmic image, that image is presented to each model of the ensemble for classification, yielding a probabilistic classification score—of each model. Using the model weights, a weighted-average of the individual model-generated probabilistic scores is computed and used for the classification.
Owner:RETINA AI HEALTH INC

Process for forming clear, wettable silicone hydrogel articles

The present invention is a process for forming ophthalmic devices such as contact lenses, comprising the steps of curing a reactive mixture comprising at least one silicone-containing component, at least one hydrophilic component and at least one protonated diluent or protonatable diluent having a Hansen solubility parameter, δp between about 2 and about 7 to form an ophthalmic device having an advancing contact angle of less than about 80°; contacting the ophthalmic device with an aqueous solution which is capable of changing the Hansen solubility parameter, δp of the protonated or protonatable co-diluent to enhance water solubility and removing said diluent(s) with said aqueous solution.
Owner:JOHNSON & JOHNSON VISION CARE INC

Adjustable foot pedal control for ophthalmic surgery

A foot pedal control for a surgical system (e.g., an ophthalmic surgery system) that adjusts to a number of different sizes of user's shoes. The foot pedal control has a treadle on which a user places his or her foot and a sensor that tracks the movements thereof. Adjustable lateral guides mount to the treadle and conform to both sides of the foot. The guides are shaped and positioned to conform to a wide variety of feet or shoes, and may easily be adjusted between users. A retractable heel stop converts between up for reference and down to enhance movement of the user's foot. A convertible handle may be stowed in a down position parallel to a base or pivoted up over the treadle for protection and ease of movement of the foot pedal control. The foot pedal control may be wireless and have various other electronic controls, and may have a dual-control treadle.
Owner:JOHNSON & JOHNSON SURGICAL VISION INC

Suspension formulations of nepafenac and other ophthalmic drugs for topical treatment of ophthalmic disorders

Topical aqueous suspension compositions of sparingly soluble ophthalmic drugs are disclosed. The compositions comprise a combination of a poloxamer or meroxapol surfactant and a glycol tonicity-adjusting agent such as propylene glycol.
Owner:NOVARTIS AG

Laterally-actuated dispenser with one-way valve for storing and dispensing metered amounts of substances

A dispenser for dispensing a substance, such as a pharmaceutical, ophthalmic, dermatological, cosmeceutical, cosmetic or other product, has a body defining a variable-volume storage chamber for storing the product. A dispensing portion of the dispenser is connected with the body and defines a bore coupled in fluid communication with the storage chamber for receiving substance therefrom, and an outlet aperture coupled in fluid communication with the bore. A one-way valve of the dispenser includes an axially-extending valve seat and an axially-extending flexible valve cover seated on the valve seat and defining a normally-closed, axially-extending seam therebetween forming a fluid-tight seal between the valve cover and valve seat. The flexible valve cover is movable relative to the valve seat and the seam is connectable in fluid communication with the outlet aperture to allow the passage of substance through the seam and out of the dispenser. The dispenser further comprises an actuator and piston assembly including a piston receivable within the bore, a manually-engageable actuator connected to the piston for moving the piston between first and second positions relative to the bore to dispense substance within the bore through the outlet aperture, and an integral, dome-shaped spring coupled to at least one of the piston and the actuator for biasing the piston in a direction from one of the first and second positions toward the other.
Owner:MEDINSTILL DEV

Ophthalmic and otorhinolaryngological device materials

Disclosed are soft, high refractive index device materials having improved strength. The materials contain microphase-separated aliphatic and aromatic domains.
Owner:ALCON INC

Drug delivery device and syringe for filling the same

The invention relates to the field of drug delivery devices. More particularly, the invention relates to implantable, refillable drug delivery devices which provide for drug delivery over sustained time periods. The present invention has particular application for ophthalmic drug delivery applications.
Owner:(OSI) EYETECH INC

Photoalignment materials having improved adhesion

The present disclosure provides for new photoalignment (co)polymer materials which demonstrate improved adhesion to a substrate. The (co)polymeric structure includes at least one photochemically active chromophore and at least one adhesion promoter group. Articles of manufacture, optical elements, ophthalmic elements and liquid crystal cells which include at least one photoalignment layer made from the photoalignment (co)polymer materials and methods for formation are also disclosed.
Owner:TRANSITIONS OPTICAL INC

Sustained release ophthalmological device and method of making and using the same

An ophthalmological implant including a layer of pharmaceutical agent and an overlying layer of a bioerodible material, a biodegradable material a bioavailable material or a mixture thereof.
Owner:SNYDER MICHAEL E +1