Swine-origin influenza A virus head protein and preparation method and application thereof
A technology of influenza virus and protein, which is applied in the head protein of porcine type A influenza virus and its preparation and application, can solve the problems of high production cost and long production cycle, reduce production cost, shorten production time, and ensure biological safety effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0028] Example 1 Influenza virus protein
[0029] The amino acid composition of the influenza protein is shown in SEQ ID NO.1.
[0030] SEQ ID NO.1:APLHLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADTYVFVGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERN
[0031] The amino acid composition of the influenza virus protein can also be: a protein whose amino acid sequence in the protein shown in SEQ ID NO.1 is substituted, deleted or added with one or several amino acids and has influenza protein antigenicity, such as SEQ ID NO.2 :
[0032] APLQLGKCNIAGWLLGNPECDLLLTASSWSYIVETSNSENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKTSSWPNHETTKGVTAACSYAGASSFYRNLLWLTKKGSSYPKLSKSYVNNKGKEVLVLWGVHHPPTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRDQAGRMNYYWTLLEPGDTITFEATGNLIAPWYAFALN;或SEQ ID NO.3:
[0033] APLQLGKCNIAGWLLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEELREQLSSVSSFERFEIFPKESSWPNHNTTKGVTAACSHAGKSSFYRNLL...
Embodiment 2
[0034] Example 2 Preparation of influenza virus protein
[0035] 1. Obtaining the target gene
[0036] The influenza virus A / California / 04 / 2009(H1N1), GenBank: FJ966082.1 selected in this experiment, was artificially synthesized according to the sequence of GenBank: FJ966082.1 (this synthesis was provided by Shanghai Sangon Bioengineering Technology Service Co., Ltd.) Acid sequence SEQ ID NO.4,
[0037] gccccatt gcatttgggt aaatgtaaca ttgctggctg gatcctggga aatccagagt gtgaatcact ctccacagca agctcatggt cctacattgt ggaaacacct agttcagaca atggaacgtg ttacccagga gatttcatcg attatgagga gctaagagag caattgagct cagtgtcatc atttgaaagg tttgagatat tccccaagac aagttcatgg cccaatcatg actcgaacaa aggtgtaacg gcagcatgtc ctcatgctgg agcaaaaagc ttctacaaaa atttaatatg gctagttaaa aaaggaaatt catacccaaa gctcagcaaa tcctacatta atgataaagg gaaagaagtc ctcgtgctat ggggcattca ccatccatct actagtgctg accaacaaag tctctatcag aatgcagata catatgtttt tgtggggtca tcaagataca gcaagaagtt caagccggaa atagcaataa gacccaaagt gagggat...
Embodiment 3
[0062] Example 3 Protein Animal Test
[0063] H1HA head region protein immunogenicity experiment:
[0064] Experimental animals: 24 SPF chickens, each group of 6 divided into 4 groups, namely: blank control group, adjuvant control group, 50 μg antigen amount group, 100 μg antigen amount group
[0065] Reagents: complete Freund's adjuvant and incomplete Freund's adjuvant were purchased from Sigma
[0066] Methods: 50 μg and 100 μg of purified H1HA head region recombinant protein were mixed with Freund's complete adjuvant for intramuscular injection immunization, and 3 weeks later, the corresponding antigen was mixed with incomplete Freund's adjuvant for booster immunization. At the same time, a blank control group and an adjuvant control group were set up. Chicken serum was collected before immunization and 10 days after the last immunization. On the 21st day after the last immunization, 50 μL containing 10 6 EID 50 The dilution of A / California / 04 / 2009 (H1N1...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 