Bacterial endotoxin detecting test paper and kit
A technology for bacterial endotoxin detection and test paper, which is applied to measurement devices, instruments, scientific instruments, etc., can solve the problems of sample and specimen preparation to be tested, affecting the measurement results, poor specificity, etc., and achieves low detection cost, convenient detection, and low cost. low effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0032] Example 1 Synthesis of Polypeptides
[0033] According to the following amino acid sequence, the limulus factor C polypeptide is chemically synthesized, and its amino acid sequence is as follows:
[0034] GFKLKGMARISCLPNGQWSNFPPKCIRECAMVSSHAEHKVKIGVEQKYGQFPQGTEVTYTCSGNYFLM.
[0035] Entrust Nanjing GenScript Biotechnology Co., Ltd. to synthesize; purity > 90%.
Embodiment 2
[0036] Example 2 Fluorescence-labeled Limulus Factor C Polypeptide
[0037] Cleaning: Take fluorescent microspheres (purchased from Bangs Lab, product number: 11233) into a centrifuge tube, add 0.1M MES (2-morpholinoethanesulfonic acid) (pH 5.0) buffer and mix well, and run at 13000rpm for 15min, Centrifuge at 4°C, discard the supernatant, and resuspend in 0.1M MES (pH 5.0) buffer for use. Activation and cleaning: the activator EDC (1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride), NHS (N-hydroxysuccinimide) and fluorescent microspheres according to the mass The ratio is 2:1.5:2 for activation, the specific operation is as follows:
[0038] Weigh EDC and NHS and add them to 0.1M MES (pH 5.0) buffer solution to dissolve, quickly take an appropriate amount into the washed fluorescent microspheres, seal them with a parafilm and place them on a 200rpm shaker at room temperature for 30min, take them out at 13000rpm for 30min , centrifuged at 4°C to remove the supern...
Embodiment 3
[0044] Example 3 Fluorescently labeled anti-bacterial endotoxin antibody
[0045] Cleaning: Take fluorescent microspheres (purchased from Bangs Lab, product number: 11233) into a centrifuge tube, add 0.1M MES (pH5.0) buffer, mix well, and centrifuge at 13000rpm, 15min, 4°C, discard the supernatant, Resuspend with 0.1M MES (pH 5.0) buffer for use. Activation and cleaning: Activate the activator EDC, NHS and fluorescent microspheres according to the mass ratio of 2:1.2:2, the specific operation is as follows:
[0046] Weigh EDC and NHS and add them to 0.1M MES (pH 5.0) buffer solution to dissolve, quickly take an appropriate amount into the washed fluorescent microspheres, seal them with a parafilm and place them on a 200rpm shaker at room temperature for 30min, take them out at 13000rpm for 30min , centrifuged at 4°C to remove the supernatant, resuspended with an equal amount of 0.1M MES (pH 6.5) buffer solution, ultrasonically mixed and washed, repeating the above operation...
PUM
Property | Measurement | Unit |
---|---|---|
Sensitivity | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com