PD-1 blocking agent and its application
A technology of PD-1, 1.PD-1, applied in the fields of medicine and biochemistry, to achieve the effect of improving killing effect and inhibiting activity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0080] 1. PD-1 blocking agent
[0081] According to the three-position structure of the interaction between PD-1 and PD-L1, figure 1 , can determine the binding region of PD-1 and PD-L1, SEQ ID No.2~3, SEQ ID No.2: ALIVYWEMEDKNIIQFV, SEQ ID No.3: KLQDAGVYRCMISYGGADYKRITVKVNA, connect these two sequences with a loop sequence, SEQ ID No.4: KFPVEKQLDLA, and change YKR in SEQ ID No.3 to AAA to avoid functional binding and obtain immune checkpoint inhibitory effect of blocking protein, that is, PD-1 blocking agent, SEQ ID No.1 :
[0082] ALIVYWEMEDKNIIQFVKFPVEKQLDLAKLQDAGVYRCMISYGGADAAAITVKVNA; PD-1 blocking agent was synthesized by the peptide synthesis department of GenScript Biotechnology Co., Ltd., with a purity of 98%.
[0083] 2. Fluorescent labeling of PD-1 blocking agent
[0084] 1) Fluorescent labeling kit: Alexa 647 Protein Labeling Kit (A20173)
[0085] 2) Prepare 1M NaHCO 3 : 1 mL of HO 2 O Add Component B, fully dissolve and mix well, store at 4°C and use withi...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap