Unlock instant, AI-driven research and patent intelligence for your innovation.

Use of small molecule polypeptide TP-7 in preparation of medicines for treating chronic kidney diseases

A technology for chronic kidney disease and small molecule peptides, which is applied in the direction of drug combinations, medical preparations containing active ingredients, and pharmaceutical formulas, and can solve the problems of no prevention and treatment drugs and intervention methods, high cost, and heavy economic burden

Pending Publication Date: 2020-05-22
NANFANG HOSPITAL OF SOUTHERN MEDICAL UNIV
View PDF7 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Globally, the number of people with chronic kidney disease progressing to end-stage renal disease (ESRD) is increasing at a rate of 5-6% per year. Patients need dialysis treatment to maintain their lives, which costs a lot and brings great harm to families and society. heavy economic burden
How to effectively inhibit and delay the occurrence and development of chronic kidney disease is an urgent problem that needs to be solved urgently, but there are currently no effective prevention and treatment drugs and intervention methods in clinical practice

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Use of small molecule polypeptide TP-7 in preparation of medicines for treating chronic kidney diseases
  • Use of small molecule polypeptide TP-7 in preparation of medicines for treating chronic kidney diseases
  • Use of small molecule polypeptide TP-7 in preparation of medicines for treating chronic kidney diseases

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0019] Example 1: The source of the small molecule polypeptide TP-7

[0020] According to the partial amino acid composition of the FNⅢ4 domain of tendin C (TNC), a small molecular polypeptide composed of 30 amino acids was artificially synthesized by Hangzhou Dangang Biotechnology Co., Ltd., named TP-7.

[0021] The amino acid sequence of the small molecule polypeptide is as follows:

[0022] SEQ ID NO. 1: EWRNGKAAIDSYRIKYAPISGGDHAEVDVP.

[0023] After sequencing verification, the small molecule polypeptide TP-7 synthesized in this example was used in the experiments of the following examples.

Embodiment 2

[0024] Example 2: TP-7 inhibits the activation and proliferation of fibroblasts caused by tenascin C (TNC) in vitro

[0025] 1. Experimental materials

[0026] Cells: Rat kidney fibroblasts (NRK-49F).

[0027] Medium: DMEM / F12 (1:1) medium containing 10% FBS.

[0028] Culture conditions: 37°C with 5% CO 2 incubator.

[0029] 2. Experimental Treatment

[0030] Rat kidney fibroblasts (NRK-49F) were treated with 1.5×10 6 Sow in a 6cm culture dish, culture for 1 day, culture in serum-free DMEM / F12 (1:1) medium for 12 hours, add tenascin C recombinant protein (50ng / ml) to stimulate the cells, and add small molecule polypeptide TP-7 at the same time (50ng / ml) co-incubated for 48 hours to collect the protein for Western blot experiment.

[0031] 3. Experimental results

[0032] Experimental results such as Figure 1A to Figure 1E As shown, the TP-7 small molecule polypeptide can effectively inhibit the activation and proliferation of fibroblasts caused by tenascin C (TNC).

Embodiment 3

[0033] Example 3: The renoprotective effect of the small molecule polypeptide TP-7 on the mouse kidney unilateral ischemia / reperfusion model

[0034] 1. Experimental animals

[0035] BABL / c mice, male, 8 weeks old, weighing 20-22g, SPF grade.

[0036] First weigh the animals, put earrings numbered, select 18 healthy mice with a weight of 20-22g, and randomly divide them into 3 groups with 6 mice in each group, which are sham operation group and unilateral renal ischemia / reperfusion The model group and the TP-7 group were injected after renal unilateral ischemia / reperfusion modeling.

[0037] 2. Experimental grouping

[0038] 1) Sham-operated group: After anesthetizing mice with 1% pentobarbital sodium at 1ml / kg body weight at 26 degrees Celsius, choose the midline abdominal incision; after local disinfection, cut the skin, subcutaneous, muscle layer and peritoneum layer by layer, and find The lateral renal pedicles were then sutured layer by layer. After local disinfection...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention relates to a small molecule polypeptide TP-7 having a function of inhibiting a renal fibrosis-promoting function of extracellular matrix tenascin C (TNC) and particularly to a use of the small molecule polypeptide TP-7 in preparation of medicines for treating chronic kidney diseases (CKD). An amino acid sequence of the polypeptide TP-7 is shown in SEQ ID NO.1. In multiple mouse kidney fibrosis models, the TP-7 has a significant effect, can obviously restore renal functions, inhibits progress of renal fibrosis, is also free of obvious toxic and side effects, and thus can be prepared into pharmaceutical preparations for treating the chronic kidney diseases.

Description

technical field [0001] The present invention relates to the use of a small molecule polypeptide, the polypeptide is a partial peptide segment of Tenascin C (TNC), named TP-7, and specifically relates to the use of the small molecule polypeptide TP-7 in the preparation of chronic kidney disease drugs the use of. Background technique [0002] Chronic Kidney Disease (CKD) refers to the disorder of chronic kidney structure and function caused by various reasons. In recent years, its incidence and prevalence have increased sharply, and it is another disease that seriously endangers human health after cardiovascular and cerebrovascular diseases, diabetes and malignant tumors. Globally, the number of people with chronic kidney disease progressing to end-stage renal disease (ESRD) is increasing at a rate of 5-6% per year. Patients need dialysis treatment to maintain their lives, which costs a lot and brings great harm to families and society. come a heavy economic burden. How to ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A61K38/17A61P13/12
CPCA61K38/1709A61P13/12
Inventor 傅海燕商静月
Owner NANFANG HOSPITAL OF SOUTHERN MEDICAL UNIV
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More