Antiviral drug combination for livestock

Abstract

An antiviral drug combination for livestock in the invention relates to an antiviral agent, in particular to an antiviral agent for poultry and livestock. The drug combination is composed of cyanovirin and animal IFN-alpha in mass ratio of 3:1. The invention initially applies cyanovirin to treating viral infection of poultry and livestock, and animal IFN-alpha which is prepared by gene recombination, is contained in species such as pig, chicken, cattle and the like and has high valence, high purity and antiviral effect and cyanovirin with direct antiviral effect are initially applied in a combining way; meanwhile the effect of cyanovirin is direct and rapid and the antiviral effect of IFN-alpha is wide and permanent, and the effect is better than that of single use of cyanovirin or IFN-alpha.

Description

Technical field

[0001] The invention relates to an antiviral agent, in particular to an antiviral agent for poultry and livestock.

Background technique

[0002] IFN-α is a cytokine with strong antiviral activity. It has been widely used in the treatment of human viral diseases and has become an essential therapy. For example, in the treatment of hepatitis C, IFN-α plays an irreplaceable role. Since the antiviral effect of IFN-α is indirect and works by inducing other antiviral mechanisms in the body, one of its important characteristics is that it has no virus specificity, that is to say, IFN-α has anti-virus activity; However, another important feature of the antiviral effect of IFN-α is species specificity, that is to say, IFN-α from a certain species is only effective against viruses infected by that species, but not against viruses infected by other species . For example, human IFN-α is only effective for human virus infection, but not for other species including ...

Examples

Embodiment 1

[0045] 1. Preparation of antiviral protein from cyanobacteria

[0046] (1) extract total RNA from cyanobacteria, amplify the gene fragment of cyanobacteria antiviral protein by RT-PCR, the amino acid sequence of cyanobacteria antiviral protein is:

[0047] LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE.

[0048] The nucleotide sequence of the cyanobacteria antiviral protein is:

[0049] cttggtaaattctcccagacctgctacaactccgctatccagggttccgttctgacctccacctgcgaacgtaccaacggtggttacaacacctcctccatcgacctgaactccgttatcgaaaacgttgacggttccctgaaatggcagccgtccaacttcatcgaaacctgccgtaacacccagctggctggttcctccgaactggctgctgaatgcaaaacccgtgctcagcagttcgtttccaccaaaatcaacctggacgaccacatcgctaacatcgacggtaccctgaaatacgaataa

[0050] (2) After sequencing to confirm that the sequence is correct, clone the above nucleotide sequence into the pET26b(+) vector and express it in E.coli BL21 competent cells;

[0051] (3) The engineered bacteria were induced to expr...

Technical field

[0001] The invention relates to an antiviral agent, in particular to an antiviral agent for poultry and livestock.

Background technique

[0002] IFN-α is a cytokine with strong antiviral activity. It has been widely used in the treatment of human viral diseases and has become an essential therapy. For example, in the treatment of hepatitis C, IFN-α plays an irreplaceable role. Since the antiviral effect of IFN-α is indirect and works by inducing other antiviral mechanisms in the body, one of its important characteristics is that it has no virus specificity, that is to say, IFN-α has anti-virus activity; However, another important feature of the antiviral effect of IFN-α is species specificity, that is to say, IFN-α from a certain species is only effective against viruses infected by that species, but not against viruses infected by other species . For example, human IFN-α is only effective for human virus infection, but not for other species including ...

Examples

Embodiment 1

[0045] 1. Preparation of antiviral protein from cyanobacteria

[0046] (1) extract total RNA from cyanobacteria, amplify the gene fragment of cyanobacteria antiviral protein by RT-PCR, the amino acid sequence of cyanobacteria antiviral protein is:

[0047] LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE.

[0048] The nucleotide sequence of the cyanobacteria antiviral protein is:

[0049] cttggtaaattctcccagacctgctacaactccgctatccagggttccgttctgacctccacctgcgaacgtaccaacggtggttacaacacctcctccatcgacctgaactccgttatcgaaaacgttgacggttccctgaaatggcagccgtccaacttcatcgaaacctgccgtaacacccagctggctggttcctccgaactggctgctgaatgcaaaacccgtgctcagcagttcgtttccaccaaaatcaacctggacgaccacatcgctaacatcgacggtaccctgaaatacgaataa

[0050] (2) After sequencing to confirm that the sequence is correct, clone the above nucleotide sequence into the pET26b(+) vector and express it in E.coli BL21 competent cells;

[0051] (3) The engineered bacteria were induced to expr...