Antiviral drug combination for livestock
An anti-virus and composition technology, applied in the direction of anti-viral agents, using vectors to introduce foreign genetic material, antibodies, etc., can solve the problems of anti-viral application restrictions and few methods
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0045] 1. Preparation of antiviral protein from cyanobacteria
[0046] (1) extract total RNA from cyanobacteria, amplify the gene fragment of cyanobacteria antiviral protein by RT-PCR, the amino acid sequence of cyanobacteria antiviral protein is:
[0047] LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE.
[0048] The nucleotide sequence of the cyanobacteria antiviral protein is:
[0049] cttggtaaattctcccagacctgctacaactccgctatccagggttccgttctgacctccacctgcgaacgtaccaacggtggttacaacacctcctccatcgacctgaactccgttatcgaaaacgttgacggttccctgaaatggcagccgtccaacttcatcgaaacctgccgtaacacccagctggctggttcctccgaactggctgctgaatgcaaaacccgtgctcagcagttcgtttccaccaaaatcaacctggacgaccacatcgctaacatcgacggtaccctgaaatacgaataa
[0050] (2) After sequencing to confirm that the sequence is correct, clone the above nucleotide sequence into the pET26b(+) vector and express it in E.coli BL21 competent cells;
[0051] (3) The engineered bacteria were induced to expr...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com